Entry information : PterCIIAB01
Entry ID 10537
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PterCIIAB01
Name PterCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora teres    [TaxId: 53485 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PterCIIAB01
start..stop
S start..stop
PtritCIIAB01 615 0 1..335 1..333
AbraCIIAB01 497 6e-179 1..335 1..327
AalteCIIAB02 482 5e-173 1..335 1..327
CberCIIAB01 430 1e-152 1..335 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23331..23940 610 N° 2 24014..24411 398  
join(23331..23940,24014..24411)


exon

Literature and cross-references PterCIIAB01
DNA ref. JGI genome:   191852 (23331..24411)
Cluster/Prediction ref. JGI gene:   6399
Protein sequence: PterCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336
PWM (Da):   %s   35172.61  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYIRNVLIAGFAAASTVEAYANSTIREEQKIWNVDHLSAPKGKRFLDGIFNVVGGILGGFGGGGGGNDEEPQCPEVWSQISKTLTEQFLGNGQCTDAARAAIRASFHDCFNGACDGSLILANECSNIENRGMERLCSNLANVATQTKVGVADLIQFAAAHAVKTCPGGPTVPVKVGRQDSNTPGALGVLPGPNVPGDTLVRSFASKGFSPIDLAALVGAHTAAKQRHSNPSKPGTSLDSTVGTWDNKFYSETKRGSAPFTLPSDKNIANHPATAIPFTTFAVSKGAWDAAFVPAMVKLGMIGVEDDGLIDCTSALPGGSRKRDIKNSNIFDRLNW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAACGTCCTCATCGCCGGCTTCGCGGCTGCCAGCACAGTCGAAGCCTACGCCAACTCTACAATCCGGGAAGAACAAAAGATCTGGAACGTCGACCATCTCAGCGCACCA
AAGGGAAAACGTTTCCTCGATGGAATCTTCAACGTAGTCGGGGGCATCCTAGGCGGCTTCGGCGGTGGTGGTGGCGGCAATGATGAAGAGCCGCAATGTCCTGAAGTCTGGTCGCAAATC
TCAAAGACACTCACCGAACAATTCCTCGGAAACGGACAATGCACAGACGCTGCTCGTGCTGCTATCCGTGCCTCCTTTCACGACTGCTTCAACGGCGCATGCGACGGCTCCCTCATCCTC
GCAAACGAGTGCTCAAACATCGAAAACCGCGGTATGGAGCGTCTATGCAGTAACCTCGCCAACGTGGCCACACAAACCAAAGTCGGTGTAGCCGACCTCATCCAATTCGCTGCTGCACAC
GCTGTCAAGACATGTCCTGGTGGCCCTACCGTTCCCGTTAAAGTCGGTCGTCAGGACTCAAACACACCGGGTGCTCTTGGTGTACTACCCGGACCCAACGTTCCAGGAGACACTTTGGTC
CGATCCTTCG
GTAAGCAACCCCCCAAAAAAAGACACCTGCTTTTTTCAAGTCTGTAGATAATCGTACTAACCCCACTTTCCAGCATCCAAAGGCTTCAGCCCTATTGACCTCGCCGCTCT
CGTCGGCGCACACACCGCTGCCAAACAACGCCACAGCAACCCCTCCAAACCCGGTACTTCCCTCGACTCTACCGTCGGTACATGGGACAACAAGTTTTACTCCGAGACCAAGCGCGGTAG
TGCGCCCTTCACTCTCCCGTCAGACAAGAACATTGCAAACCACCCGGCCACCGCAATCCCCTTCACTACCTTTGCCGTCAGCAAGGGCGCGTGGGACGCAGCCTTCGTGCCTGCCATGGT
TAAGCTAGGTATGATCGGCGTAGAGGACGATGGTCTCATCGACTGCACTTCTGCACTACCCGGCGGTAGCAGGAAGAGGGATATTAAGAACAGCAACATTTTCGACAGGCTGAACTGGTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAACGTCCTCATCGCCGGCTTCGCGGCTGCCAGCACAGTCGAAGCCTACGCCAACTCTACAATCCGGGAAGAACAAAAGATCTGGAACGTCGACCATCTCAGCGCACCA
AAGGGAAAACGTTTCCTCGATGGAATCTTCAACGTAGTCGGGGGCATCCTAGGCGGCTTCGGCGGTGGTGGTGGCGGCAATGATGAAGAGCCGCAATGTCCTGAAGTCTGGTCGCAAATC
TCAAAGACACTCACCGAACAATTCCTCGGAAACGGACAATGCACAGACGCTGCTCGTGCTGCTATCCGTGCCTCCTTTCACGACTGCTTCAACGGCGCATGCGACGGCTCCCTCATCCTC
GCAAACGAGTGCTCAAACATCGAAAACCGCGGTATGGAGCGTCTATGCAGTAACCTCGCCAACGTGGCCACACAAACCAAAGTCGGTGTAGCCGACCTCATCCAATTCGCTGCTGCACAC
GCTGTCAAGACATGTCCTGGTGGCCCTACCGTTCCCGTTAAAGTCGGTCGTCAGGACTCAAACACACCGGGTGCTCTTGGTGTACTACCCGGACCCAACGTTCCAGGAGACACTTTGGTC
CGATCCTTCG
CATCCAAAGGCTTCAGCCCTATTGACCTCGCCGCTCTCGTCGGCGCACACACCGCTGCCAAACAACGCCACAGCAACCCCTCCAAACCCGGTACTTCCCTCGACTCTACC
GTCGGTACATGGGACAACAAGTTTTACTCCGAGACCAAGCGCGGTAGTGCGCCCTTCACTCTCCCGTCAGACAAGAACATTGCAAACCACCCGGCCACCGCAATCCCCTTCACTACCTTT
GCCGTCAGCAAGGGCGCGTGGGACGCAGCCTTCGTGCCTGCCATGGTTAAGCTAGGTATGATCGGCGTAGAGGACGATGGTCTCATCGACTGCACTTCTGCACTACCCGGCGGTAGCAGG
AAGAGGGATATTAAGAACAGCAACATTTTCGACAGGCTGAACTGGTAG

Retrieve as FASTA