Entry information : PterCIIAC01
Entry ID 10538
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PterCIIAC01
Name PterCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora teres    [TaxId: 53485 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PterCIIAC01
start..stop
S start..stop
PtritCIIAC01 662 0 1..348 1..348
AbraCIIAC02 518 0 1..348 1..348
AalteCIIAC02 505 0 1..348 1..347
LmaCIIAC02 494 2e-177 12..348 12..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29269..29509 241 N° 2 28413..29218 806  
complement(join(28413..29218,29269..29509))


exon

Literature and cross-references PterCIIAC01
DNA ref. JGI genome:   191448 (29509..28413)
Cluster/Prediction ref. JGI gene:   5640
Protein sequence: PterCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (328)
PWM (Da):   %s   38083.43 (35889.2)  
PI (pH):   %s   6.31 (6.11) Peptide Signal:   %s   cut: 21 range:21-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLYNSARVLPILALSLLASAGPLETREPVPGIIDNILTGILSGVGQLIKDVLSGAKSAIDDTKSNKPLTCSFLATDKCCIWWDVSAELTKLFVNPDLTCNDNARAAVRMGFHDAGAWDQDQTHGGADGSILMDFKEIDRPENRGLEDVRLVLRGVQAKFKVGYADLAQYAHNHASISCPKGPRVRTFVGRKDATQAAPEGFLPDTRDPADKLITLFERKGFSPHDLAALLGAHSTARQRFVDTTPEISGKPLDTTIGVWDVEFYNDTLNNPSGATLAQKVFVLPSDKVLSEHPKVSEEWKSFVGDQKHWNEDYAKAYVRMSLTGVTKDQLNNLVDCTKTLPASRNVFP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTACAACTCTGCGCGGGTACTTCCTATTCTCGCTCTCAGCCTCCTGGCCTCAGCAGGGCCCTTGGAGACGCGAGAACCTGTGCCAGGCATCATTGATAACATCTTGACTGGTATT
CTCTCTGGCGTTGGACAGCTCATCAAAGACGTTCTTTCTGGTGCCAAGTCGGCCATCGACGACACAAAATCAAACAAGCCTTTAACATGTTCATTTCTTGCTACGGACAAGTGCTGTATC
T
GTAAGTTCCCAGCAAGATGACTTTCTATTCCTATGCTAATAACCTTGTAGGGTGGGACGTTTCTGCTGAACTCACCAAGTTGTTTGTCAACCCGGATTTGACTTGCAACGACAACGCTC
GCGCAGCAGTCCGTATGGGGTTCCACGATGCGGGCGCATGGGATCAGGACCAAACACATGGCGGTGCCGATGGATCAATATTGATGGACTTTAAAGAGATCGATCGCCCAGAGAACAGAG
GCCTTGAGGACGTACGTCTTGTGCTTCGTGGCGTACAAGCGAAGTTCAAGGTTGGCTACGCAGACCTTGCCCAGTATGCCCACAACCACGCCAGCATCTCATGCCCAAAAGGCCCTCGTG
TGCGTACCTTCGTTGGACGCAAGGATGCTACCCAGGCTGCACCTGAAGGGTTTCTTCCGGATACTCGCGACCCCGCCGATAAACTCATTACTCTCTTCGAGCGCAAGGGTTTCAGCCCCC
ACGACCTTGCCGCGCTCCTAGGTGCCCATTCAACAGCCCGCCAACGCTTTGTCGACACTACTCCCGAAATCTCTGGCAAGCCTCTTGATACTACCATTGGTGTTTGGGATGTCGAGTTCT
ACAACGACACGCTTAATAACCCATCAGGTGCCACTCTTGCACAGAAAGTCTTCGTACTCCCTAGCGACAAGGTACTTTCGGAACACCCCAAGGTCAGCGAGGAGTGGAAGTCATTCGTTG
GTGACCAGAAGCACTGGAATGAGGACTACGCAAAGGCGTACGTCAGGATGAGTCTGACTGGTGTGACAAAAGATCAGTTGAACAACTTGGTCGACTGCACAAAGACGCTGCCGGCTAGCC
GGAACGTTTTCCCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTACAACTCTGCGCGGGTACTTCCTATTCTCGCTCTCAGCCTCCTGGCCTCAGCAGGGCCCTTGGAGACGCGAGAACCTGTGCCAGGCATCATTGATAACATCTTGACTGGTATT
CTCTCTGGCGTTGGACAGCTCATCAAAGACGTTCTTTCTGGTGCCAAGTCGGCCATCGACGACACAAAATCAAACAAGCCTTTAACATGTTCATTTCTTGCTACGGACAAGTGCTGTATC
T
GGTGGGACGTTTCTGCTGAACTCACCAAGTTGTTTGTCAACCCGGATTTGACTTGCAACGACAACGCTCGCGCAGCAGTCCGTATGGGGTTCCACGATGCGGGCGCATGGGATCAGGAC
CAAACACATGGCGGTGCCGATGGATCAATATTGATGGACTTTAAAGAGATCGATCGCCCAGAGAACAGAGGCCTTGAGGACGTACGTCTTGTGCTTCGTGGCGTACAAGCGAAGTTCAAG
GTTGGCTACGCAGACCTTGCCCAGTATGCCCACAACCACGCCAGCATCTCATGCCCAAAAGGCCCTCGTGTGCGTACCTTCGTTGGACGCAAGGATGCTACCCAGGCTGCACCTGAAGGG
TTTCTTCCGGATACTCGCGACCCCGCCGATAAACTCATTACTCTCTTCGAGCGCAAGGGTTTCAGCCCCCACGACCTTGCCGCGCTCCTAGGTGCCCATTCAACAGCCCGCCAACGCTTT
GTCGACACTACTCCCGAAATCTCTGGCAAGCCTCTTGATACTACCATTGGTGTTTGGGATGTCGAGTTCTACAACGACACGCTTAATAACCCATCAGGTGCCACTCTTGCACAGAAAGTC
TTCGTACTCCCTAGCGACAAGGTACTTTCGGAACACCCCAAGGTCAGCGAGGAGTGGAAGTCATTCGTTGGTGACCAGAAGCACTGGAATGAGGACTACGCAAAGGCGTACGTCAGGATG
AGTCTGACTGGTGTGACAAAAGATCAGTTGAACAACTTGGTCGACTGCACAAAGACGCTGCCGGCTAGCCGGAACGTTTTCCCATAG

Retrieve as FASTA