Entry information : OsPrx44
Entry ID 1054
Creation 2005-06-16 (Filippo Passardi)
Last sequence changes 2005-06-16 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx44
Name OsPrx44
Class Class III peroxidase    [Orthogroup: Prx122]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx44
start..stop
S start..stop
SiPrx170 545 0 3..323 2..322
SiPrx172 543 0 3..323 2..322
OsPrx42 537 0 1..323 1..323
BdiPrx41 533 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14287889..14288098 210 N° 2 14288888..14289649 762  
join(14287889..14288098,14288888..14289649)


exon

Literature and cross-references OsPrx44
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1P9
DNA ref. GenBank:   NC_008396.1 (14287889..14289646)
Protein sequence: OsPrx44
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (299)
PWM (Da):   %s   34714.63 (32404.4)  
PI (pH):   %s   7.67 (7.41) Peptide Signal:   %s   cut: 25 range:25-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAHTIKLAVAVTCTLLLAAACSGLEVGYYKKSCPRVETIVREEVKKFVYKNAGIGAGLIRLLFHDCFVEGCDGSVLLDPTPANPAPEKLSPPNFPSLRGFEVIDAAKDAVEKACPGVVSCADIVAFAARDAAYFLSRMRVKINMPAGRFDGRHSNSSDALDNLPPPFFNVTELVDIFATKGLDAEDMVVLSGAHTVGRSHCSSFVPDRLAVASDIDGGFAGLLRRRCPANPTTAHDPTVNQDVVTPNAFDNQYYKNVIAHKVLFTSDAALLTSPATAKMVSDNANIPGWWEDRFKKAFVKMAAVDVKNGYQGEIRKNCRVVN*

Retrieve as FASTA  
Remarks chromosome 3; no ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCACACACAATTAAGCTCGCCGTCGCGGTGACTTGCACGCTGCTCCTTGCAGCCGCGTGCAGTGGCTTGGAGGTTGGCTACTACAAGAAGTCGTGCCCCCGCGTTGAGACCATC
GTGAGGGAGGAGGTGAAGAAGTTCGTCTACAAGAACGCCGGCATCGGCGCCGGCCTCATCCGCTTGCTCTTCCATGACTGCTTCGTCGAG
GTACATACATGGCTGAACCTATAGCAAGAT
ATATGGGCAGCTGCATTTATATTTTTTTGAAATTTACGGTTCGAGTACCAGAAATATTTTTGTTCTATAAATGTGAATTGTCATGCCGCCCCTCTGGTACCCGAGTTATTATGAAATGAC
AATTTTTTTATATTAATGTGATAATTCCCAAAATTTTCTTACGGTTCATTAAAAATACTCGTATCTTTTTGAGTAAAAATAATTTTATGATTGTTGAGGAGGTACTGAAAGATATAATAT
TTGGTTAATTAATTTGAGATACCTCTGGCCAACTTTTCTATTTTGGAAAACCCCTTGAAAAAAAAAATTTAAGCAGCGGTAGACTTAAGCTTTCGGTAATGTAGGACCAATTGAAATTTA
AACAAATTTTATTTAAATTAGTTTTGGTAATTAACTTAGTACCTAAACACTGAAAAGTTACTCCCTCCGTATTTTAATATATGACGCCGTTAACTTTTTGATAGACGTTTGACCTTTCGT
CTTATTAAAAAAATTTATGTAATTATAATTTATTTTATTGTGACTTGATTTATCATCAAATGTTCTTTAAGCATGACATAAGTATTTTTATATTTGCATAAAAATTTTGAATAATACGAG
TGGTTAAACGTTGTTCGAAAAGTCAACGGTGTCATACATTAAAATACGGAGGGAGTACTAAATTTTGCACTACAAAATGTATTAACAAACCAAAGAAAAATTGTACATATTTGCATATCA
GTGAGCTTGACGCGCCACATCTGCATGTATATTTTACAGGGATGTGATGGCTCGGTGCTCCTGGACCCAACTCCGGCGAACCCAGCCCCGGAGAAGCTGAGCCCGCCCAACTTCCCCAGC
CTCCGCGGCTTCGAGGTGATCGACGCCGCCAAGGACGCCGTCGAGAAGGCCTGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACGCCGCCTACTTCCTCAGC
AGGATGAGGGTCAAGATCAACATGCCGGCGGGCCGCTTCGACGGCCGCCACTCCAACTCCTCCGACGCCCTCGACAACCTCCCCCCGCCCTTCTTCAACGTCACCGAGCTCGTCGACATC
TTCGCCACCAAGGGCCTCGACGCCGAGGACATGGTGGTGCTCTCCGGCGCCCACACCGTCGGCCGCTCCCACTGCTCCTCCTTCGTCCCCGACCGCCTCGCCGTCGCCTCCGACATCGAC
GGCGGCTTCGCCGGGCTCCTCAGGAGGAGGTGCCCCGCCAACCCGACCACGGCGCACGACCCCACCGTGAACCAGGATGTCGTCACCCCCAACGCGTTCGACAACCAGTACTACAAGAAC
GTCATTGCCCACAAGGTGCTCTTCACGTCGGACGCGGCGCTGCTGACCTCGCCGGCGACGGCGAAGATGGTGTCGGACAACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCAAGAAG
GCGTTCGTCAAGATGGCCGCCGTCGACGTCAAAAACGGCTACCAGGGCGAGATCAGGAAGAACTGCAGGGTGGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCACACACAATTAAGCTCGCCGTCGCGGTGACTTGCACGCTGCTCCTTGCAGCCGCGTGCAGTGGCTTGGAGGTTGGCTACTACAAGAAGTCGTGCCCCCGCGTTGAGACCATC
GTGAGGGAGGAGGTGAAGAAGTTCGTCTACAAGAACGCCGGCATCGGCGCCGGCCTCATCCGCTTGCTCTTCCATGACTGCTTCGTCGAG
GGATGTGATGGCTCGGTGCTCCTGGACCCA
ACTCCGGCGAACCCAGCCCCGGAGAAGCTGAGCCCGCCCAACTTCCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCCGCCAAGGACGCCGTCGAGAAGGCCTGCCCGGGCGTCGTCTCC
TGCGCCGACATCGTCGCCTTCGCCGCCCGCGACGCCGCCTACTTCCTCAGCAGGATGAGGGTCAAGATCAACATGCCGGCGGGCCGCTTCGACGGCCGCCACTCCAACTCCTCCGACGCC
CTCGACAACCTCCCCCCGCCCTTCTTCAACGTCACCGAGCTCGTCGACATCTTCGCCACCAAGGGCCTCGACGCCGAGGACATGGTGGTGCTCTCCGGCGCCCACACCGTCGGCCGCTCC
CACTGCTCCTCCTTCGTCCCCGACCGCCTCGCCGTCGCCTCCGACATCGACGGCGGCTTCGCCGGGCTCCTCAGGAGGAGGTGCCCCGCCAACCCGACCACGGCGCACGACCCCACCGTG
AACCAGGATGTCGTCACCCCCAACGCGTTCGACAACCAGTACTACAAGAACGTCATTGCCCACAAGGTGCTCTTCACGTCGGACGCGGCGCTGCTGACCTCGCCGGCGACGGCGAAGATG
GTGTCGGACAACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCAAGAAGGCGTTCGTCAAGATGGCCGCCGTCGACGTCAAAAACGGCTACCAGGGCGAGATCAGGAAGAACTGCAGG
GTGGTCAACTAA

Retrieve as FASTA