Entry information : COsaCIIAB02
Entry ID 10542
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: COsaCIIAB02
Name COsaCIIAB02
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus sativus    [TaxId: 45130 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value COsaCIIAB02
start..stop
S start..stop
CheCIIAB02_C5 541 0 1..285 1..288
CheCIIAB02_C4 541 0 1..285 1..288
ClunCIIAB02 290 8e-99 3..274 4..278
Ssrc1lsm3aCIIAB06 287 2e-97 1..276 1..278
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 971059..971724 666 N° 2 971838..972029 192  
join(971059..971724,971838..972029)


exon

Literature and cross-references COsaCIIAB02
DNA ref. JGI genome:   scaffold_14 (971059..972029)
Cluster/Prediction ref. JGI gene:   150777
Protein sequence: COsaCIIAB02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286 (266)
PWM (Da):   %s   30564.25 (28614.2)  
PI (pH):   %s   6.5 (5.92) Peptide Signal:   %s   cut: 20 range:20-285
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRPISLALAVLTATTPVSALNLLPRTCPAVWTDVAASFEKQLTSCGKFAHTLIRLAFHDCNSGCDGSIILTGECSSTQNRGLNDTCNTLRSMRTQFNVGAADIIQFGAALAIAACPLGPHVQAFVGRPDSATAAPVGSLPHSSDSPEKLIADFRAIGISAQEMIALLGTHSVAVQLFDDPKQAGKGLDSTPSTYDTLYYNQTKFRTAPYTLQSDFELAHYNETADIWDSFINSADLWNQVFVPAWFKMSTVGVDTSNLQDCSDLVPASKTKRGRSVDGVAKKFRG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCCCATATCCCTAGCCCTCGCCGTCCTCACGGCAACAACCCCCGTCTCAGCCCTCAACCTCCTCCCACGCACCTGTCCCGCAGTCTGGACCGACGTCGCCGCCTCGTTCGAAAAA
CAACTAACCAGCTGCGGCAAATTCGCCCACACCCTCATCCGCCTCGCCTTCCACGACTGCAACTCCGGCTGCGACGGCAGCATAATTCTCACCGGTGAATGCTCATCCACTCAAAACCGC
GGCTTAAATGACACGTGCAACACCCTCCGCAGCATGCGCACCCAATTCAACGTCGGCGCAGCCGATATCATCCAATTCGGCGCCGCCCTCGCCATCGCCGCCTGTCCGCTAGGCCCCCAC
GTGCAAGCCTTCGTGGGCCGCCCCGACAGCGCTACAGCCGCGCCCGTGGGATCCCTCCCGCACAGCAGCGATTCCCCCGAGAAGCTAATTGCGGACTTCCGCGCCATAGGTATCTCAGCG
CAGGAAATGATTGCGCTCTTAGGCACGCATAGTGTGGCGGTGCAGCTGTTTGATGATCCGAAGCAGGCTGGGAAGGGGCTTGATAGCACGCCCTCGACGTATGATACCTTGTATTATAAT
CAGACCAAGTTTCGGACGGCTCCGTATACGCTTCAGAGTGATTTTGAGCTCGCGCATTATAATGAG
GTGTGTACTTCCCCCCCCCTCCCCCCCTCTCCTTTTTTTGTCTCCTTTTGCCAT
TGTTCAATACTTTTCTTCGCTGTAGAACCTTACATATATTGACGTGGATGTGAATCTAGACTGCAGATATTTGGGACTCATTCATCAACTCTGCGGACTTGTGGAATCAAGTTTTCGTCC
CGGCGTGGTTTAAGATGTCAACTGTGGGTGTAGACACGAGTAATTTGCAGGATTGCTCGGATCTTGTTCCGGCTAGTAAGACGAAACGTGGTAGGAGCGTGGATGGGGTGGCGAAGAAGT
TTAGGGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCCCATATCCCTAGCCCTCGCCGTCCTCACGGCAACAACCCCCGTCTCAGCCCTCAACCTCCTCCCACGCACCTGTCCCGCAGTCTGGACCGACGTCGCCGCCTCGTTCGAAAAA
CAACTAACCAGCTGCGGCAAATTCGCCCACACCCTCATCCGCCTCGCCTTCCACGACTGCAACTCCGGCTGCGACGGCAGCATAATTCTCACCGGTGAATGCTCATCCACTCAAAACCGC
GGCTTAAATGACACGTGCAACACCCTCCGCAGCATGCGCACCCAATTCAACGTCGGCGCAGCCGATATCATCCAATTCGGCGCCGCCCTCGCCATCGCCGCCTGTCCGCTAGGCCCCCAC
GTGCAAGCCTTCGTGGGCCGCCCCGACAGCGCTACAGCCGCGCCCGTGGGATCCCTCCCGCACAGCAGCGATTCCCCCGAGAAGCTAATTGCGGACTTCCGCGCCATAGGTATCTCAGCG
CAGGAAATGATTGCGCTCTTAGGCACGCATAGTGTGGCGGTGCAGCTGTTTGATGATCCGAAGCAGGCTGGGAAGGGGCTTGATAGCACGCCCTCGACGTATGATACCTTGTATTATAAT
CAGACCAAGTTTCGGACGGCTCCGTATACGCTTCAGAGTGATTTTGAGCTCGCGCATTATAATGAG
ACTGCAGATATTTGGGACTCATTCATCAACTCTGCGGACTTGTGGAATCAAGTT
TTCGTCCCGGCGTGGTTTAAGATGTCAACTGTGGGTGTAGACACGAGTAATTTGCAGGATTGCTCGGATCTTGTTCCGGCTAGTAAGACGAAACGTGGTAGGAGCGTGGATGGGGTGGCG
AAGAAGTTTAGGGGGTGA

Retrieve as FASTA