Entry information : COsaCIIAB01
Entry ID 10545
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: COsaCIIAB01
Name COsaCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus sativus    [TaxId: 45130 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value COsaCIIAB01
start..stop
S start..stop
CheCIIAB01_C5 631 0 1..329 1..329
CheCIIAB01_C4 631 0 1..329 1..329
ClunCIIAB03 488 2e-175 1..327 1..331
AalteCIIAB02 432 1e-153 1..329 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 396249..396837 589 N° 2 395785..396185 401  
complement(join(395785..396185,396249..396837))


exon

Literature and cross-references COsaCIIAB01
DNA ref. JGI genome:   scaffold_17 (396837..395785)
Cluster/Prediction ref. JGI gene:   152826
Protein sequence: COsaCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (310)
PWM (Da):   %s   35316.76 (33171.6)  
PI (pH):   %s   8.58 (8.40) Peptide Signal:   %s   cut: 20 range:20-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYIRNILVSGLAAASTVQAYNNDTFGEDEKWIVADPAPVQKRQFINVFGLLSSIFGGGNKQDTSECPAIWTQISATLTQQFSANGECTDAARAAIRAAFHDCFPGACDGSLILANECAQAPSRGLQRFCSNLAGVASQTNVGVGDLIQFAAAHAVKTCPEGPVVPIRIGRQDSSRENDWRILPRGDARGNDVVRLFSSKGFSPVDLAALLGAHSTAKQQFVDPSQAGAALDSTPGVWDIKYYTETLRGNAPFILPADRNIARNPATALAFARFGVSKKAWDDAFVVAMVKMGMMGVTNRNMIDCTSALPKSSAAKREVKERRVSGRFTW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAATATTCTGGTCTCTGGCCTAGCGGCTGCCAGCACAGTCCAAGCCTACAACAACGACACATTCGGCGAAGATGAGAAGTGGATAGTGGCAGATCCAGCTCCAGTACAG
AAACGACAGTTCATCAACGTCTTCGGCCTACTCAGCAGCATCTTCGGCGGCGGCAACAAACAAGATACAAGCGAATGCCCTGCCATCTGGACCCAAATATCCGCCACTCTTACCCAACAA
TTCTCCGCAAACGGCGAATGCACAGATGCTGCTCGGGCCGCCATCCGAGCTGCTTTCCACGACTGCTTCCCAGGAGCTTGTGATGGCTCTCTCATCCTAGCCAACGAGTGTGCACAAGCC
CCCAGCCGCGGCCTCCAGCGCTTCTGCAGCAACCTCGCAGGTGTAGCCTCGCAAACCAACGTCGGCGTCGGAGATCTCATCCAGTTCGCCGCCGCACACGCCGTCAAGACATGTCCTGAA
GGACCCGTCGTCCCCATCCGAATCGGGCGACAAGATTCTAGCCGCGAAAACGACTGGAGAATACTACCACGAGGCGATGCCAGAGGAAACGATGTCGTCAGATTATTCT
GTAAGTTCCCT
CCAAACAATATTCCTTGAGAGAAACCCCTCTTTCTAACAATATACACAACAGCATCCAAAGGTTTTAGCCCCGTCGATCTCGCCGCCCTCCTCGGCGCCCACTCAACCGCCAAACAACAA
TTCGTCGACCCCTCCCAAGCCGGCGCCGCTCTCGACTCCACCCCAGGCGTCTGGGACATCAAATACTACACCGAGACTCTGCGTGGAAATGCACCCTTCATCCTCCCAGCCGACAGAAAT
ATTGCGAGGAACCCGGCGACTGCGCTGGCTTTTGCGCGGTTTGGGGTTAGTAAGAAGGCGTGGGATGATGCGTTTGTTGTGGCTATGGTTAAGATGGGGATGATGGGTGTGACGAATCGG
AATATGATTGATTGTACAAGTGCGTTGCCGAAGAGTAGTGCGGCGAAGAGGGAGGTTAAGGAGAGGAGGGTTTCGGGGAGGTTTACGTGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAATATTCTGGTCTCTGGCCTAGCGGCTGCCAGCACAGTCCAAGCCTACAACAACGACACATTCGGCGAAGATGAGAAGTGGATAGTGGCAGATCCAGCTCCAGTACAG
AAACGACAGTTCATCAACGTCTTCGGCCTACTCAGCAGCATCTTCGGCGGCGGCAACAAACAAGATACAAGCGAATGCCCTGCCATCTGGACCCAAATATCCGCCACTCTTACCCAACAA
TTCTCCGCAAACGGCGAATGCACAGATGCTGCTCGGGCCGCCATCCGAGCTGCTTTCCACGACTGCTTCCCAGGAGCTTGTGATGGCTCTCTCATCCTAGCCAACGAGTGTGCACAAGCC
CCCAGCCGCGGCCTCCAGCGCTTCTGCAGCAACCTCGCAGGTGTAGCCTCGCAAACCAACGTCGGCGTCGGAGATCTCATCCAGTTCGCCGCCGCACACGCCGTCAAGACATGTCCTGAA
GGACCCGTCGTCCCCATCCGAATCGGGCGACAAGATTCTAGCCGCGAAAACGACTGGAGAATACTACCACGAGGCGATGCCAGAGGAAACGATGTCGTCAGATTATTCT
CATCCAAAGGT
TTTAGCCCCGTCGATCTCGCCGCCCTCCTCGGCGCCCACTCAACCGCCAAACAACAATTCGTCGACCCCTCCCAAGCCGGCGCCGCTCTCGACTCCACCCCAGGCGTCTGGGACATCAAA
TACTACACCGAGACTCTGCGTGGAAATGCACCCTTCATCCTCCCAGCCGACAGAAATATTGCGAGGAACCCGGCGACTGCGCTGGCTTTTGCGCGGTTTGGGGTTAGTAAGAAGGCGTGG
GATGATGCGTTTGTTGTGGCTATGGTTAAGATGGGGATGATGGGTGTGACGAATCGGAATATGATTGATTGTACAAGTGCGTTGCCGAAGAGTAGTGCGGCGAAGAGGGAGGTTAAGGAG
AGGAGGGTTTCGGGGAGGTTTACGTGGTAG

Retrieve as FASTA