Entry information : COsaCIIAB03
Entry ID 10546
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-02-27 (Christophe Dunand)
Peroxidase information: COsaCIIAB03
Name COsaCIIAB03
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus sativus    [TaxId: 45130 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value COsaCIIAB03
start..stop
S start..stop
CheCIIAB03_C5 495 1e-179 1..294 1..294
CheCIIAB03_C4 495 1e-179 1..294 1..294
ClunCIIAB01 342 4e-119 1..294 1..295
ClunCIIAB02 313 2e-107 2..292 3..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84157..84831 675 N° 2 83873..84088 216  
complement(join(83873..84088,84157..84831))


exon

Literature and cross-references COsaCIIAB03
DNA ref. JGI genome:   scaffold_20 (84831..83873)
Protein sequence: COsaCIIAB03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   297 (277)
PWM (Da):   %s   31338.93 (29548.0)  
PI (pH):   %s   8.98 (8.98) Peptide Signal:   %s   cut: 19 range:19-295
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHPASIALFALAVTPISAVDASPRAGTCPAVWQTIAADLTNIFQGCNKAAHSAVRAVLHACLPLGCNGSLILSQEECSRVENLGLRDLCKTLNQKRTQYRVGAADMVQFAGAMSLSACPLGPQVQALVGRRDSSADAPPTGLPRSRDPVQKILSMFAAKGFSPQDVVALLGTHSIVIQV*DDPARAGASLDSTPSICDIRYYAETKAGTAPYSLQSDRLMSSAAETYRS*AVFAKSTTLWANAFTSAWNRFAVIGNNVQSLQDCSHLVPKSKVPRGRQVAHAQMMEKLTKKFIAEEH

Retrieve as FASTA  
Remarks Complete sequence ( 1 intron and sequencing error: two stop codon in frame) or pseudogen. Incorrect prediction from JGI (longer 5' with two extra introns and two extra introns in 3' to bypass the two stop codons in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCCTGCGTCCATCGCCCTCTTTGCCCTTGCCGTGACGCCCATCTCTGCCGTGGACGCCTCGCCTCGCGCGGGCACCTGCCCCGCTGTTTGGCAAACTATAGCTGCCGATCTCACG
AATATCTTTCAAGGTTGCAACAAAGCAGCTCACTCAGCCGTTCGCGCTGTGCTCCATGCCTGTTTGCCTCTTGGCTGCAACGGCAGCTTGATCCTTTCCCAGGAAGAATGCTCACGGGTC
GAGAACCTTGGACTGAGAGATCTCTGTAAGACACTCAACCAGAAGCGCACCCAGTATCGTGTTGGTGCTGCTGACATGGTCCAATTTGCTGGTGCAATGTCACTTTCAGCATGCCCGCTC
GGCCCCCAGGTTCAGGCGCTTGTAGGCAGAAGAGACAGCTCAGCAGATGCACCACCAACCGGCCTACCGAGGAGCCGGGATCCTGTCCAAAAGATCTTGAGCATGTTCGCAGCTAAGGGC
TTCTCCCCTCAAGACGTGGTTGCGCTACTTGGAACACACAGCATAGTGATCCAGGTCTAAGATGATCCCGCGAGAGCCGGTGCATCACTCGACTCGACGCCCAGCATTTGCGACATTAGG
TATTACGCAGAGACGAAGGCCGGTACTGCCCCTTATAGTCTTCAAAGCGATCGTCTCATGTCTAGCGCGGCCGAG
GTGCGTATTCTGCTTGTGATCAATACGTTTGATATAATGATATGC
AACTAACTAGTATTGAATCATAGACTTATAGATCATAGGCCGTCTTCGCAAAGTCGACAACGTTATGGGCCAATGCTTTCACAAGTGCATGGAACCGGTTCGCGGTCATTGGCAACAACG
TACAGAGTCTCCAGGACTGCTCTCATCTTGTCCCCAAGTCCAAAGTTCCTCGTGGCAGACAGGTGGCTCATGCACAAATGATGGAAAAGTTGACCAAGAAGTTCATAGCAGAGGAGCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCCTGCGTCCATCGCCCTCTTTGCCCTTGCCGTGACGCCCATCTCTGCCGTGGACGCCTCGCCTCGCGCGGGCACCTGCCCCGCTGTTTGGCAAACTATAGCTGCCGATCTCACG
AATATCTTTCAAGGTTGCAACAAAGCAGCTCACTCAGCCGTTCGCGCTGTGCTCCATGCCTGTTTGCCTCTTGGCTGCAACGGCAGCTTGATCCTTTCCCAGGAAGAATGCTCACGGGTC
GAGAACCTTGGACTGAGAGATCTCTGTAAGACACTCAACCAGAAGCGCACCCAGTATCGTGTTGGTGCTGCTGACATGGTCCAATTTGCTGGTGCAATGTCACTTTCAGCATGCCCGCTC
GGCCCCCAGGTTCAGGCGCTTGTAGGCAGAAGAGACAGCTCAGCAGATGCACCACCAACCGGCCTACCGAGGAGCCGGGATCCTGTCCAAAAGATCTTGAGCATGTTCGCAGCTAAGGGC
TTCTCCCCTCAAGACGTGGTTGCGCTACTTGGAACACACAGCATAGTGATCCAGGTCTAAGATGATCCCGCGAGAGCCGGTGCATCACTCGACTCGACGCCCAGCATTTGCGACATTAGG
TATTACGCAGAGACGAAGGCCGGTACTGCCCCTTATAGTCTTCAAAGCGATCGTCTCATGTCTAGCGCGGCCGAG
ACTTATAGATCATAGGCCGTCTTCGCAAAGTCGACAACGTTATGG
GCCAATGCTTTCACAAGTGCATGGAACCGGTTCGCGGTCATTGGCAACAACGTACAGAGTCTCCAGGACTGCTCTCATCTTGTCCCCAAGTCCAAAGTTCCTCGTGGCAGACAGGTGGCT
CATGCACAAATGATGGAAAAGTTGACCAAGAAGTTCATAGCAGAGGAGCAC

Retrieve as FASTA