Entry information : PcriCIIBB02
Entry ID 10549
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-06-01 (Catherine Mathe)
Peroxidase information: PcriCIIBB02
Name PcriCIIBB02
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriCIIBB02
start..stop
S start..stop
PcriCIIBB07 472 3e-168 5..358 3..357
PcriCIIBB05 439 2e-155 1..358 1..356
HanCIIBB04 438 8e-155 7..358 6..355
PcriCIIBB03 436 5e-154 5..358 3..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 476488..476542 55 N° 2 476604..476734 131 N° 3 476858..476925 68 N° 4 476982..477122 141
N° 5 477171..477292 122 N° 6 477347..477548 202 N° 7 477601..477713 113 N° 8 477772..478009 238
N° 9 478066..478081 16  
join(476488..476542,476604..476734,476858..476925,476982..477122,477171..477292, 477347..477548,477601..477713,477772..478009,478066..478081)


exon

Literature and cross-references PcriCIIBB02
DNA ref. JGI genome:   scaffold_12 (476488..478081)
Cluster/Prediction ref. JGI gene:   43914
Protein sequence: PcriCIIBB02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (342)
PWM (Da):   %s   38213.92 (36133.8)  
PI (pH):   %s   4.73 (4.66) Peptide Signal:   %s   cut: 20 range:20-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFTFKVLSFVGALGVANAALTRRVTCPDGKNTAVNPKCCALYPVIEDIQANLFDGGKCDEAHESLRLTFHDAIGFSNSQGAAGGGGADGSIIIFSDPEVLYDANEGIDVIVELQKPFVARHANVVSVGDFIQLAGAIGLTNCPGAPRIDFYMGRPNATAAAPDNTVPEPHNADQILSRFADAGFNADEVVALLASHSVGAADVVDHDLPGSPFDSTPYQFDTQFYIETQLRGTGYPGTINQGQAKSPVGGEIRIESDQFISRDPRTACEFQSMTDQAKMQSKFAAAMVKMSVLGHTIDKLTDCSEVIPTPAAVATRPHLPAGKHMRDIEPACSATPYPTLTADKGPATTVQRVPIPK

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCACGTTCAAGGTCCTTTCCTTCGTCGGAGCGCTCGGTGTGGCCAACGGTACGCGACGGACTGTATCCACGCGAGTCAAGTCGAAACTGACCGGTCGTCGTTTTTGTAGCCGC
TTTGACGCGCCGCGTTACTTGCCCAGACGGCAAGAACACTGCTGTGAACCCCAAATGCTGCGCGTTGTACCCCGTCATAGAGGATATCCAAGCCAACCTGTTTGACGGCGGCAAGTGCGA
CGAAAAC
GTATGTGCTCTCCGCGCATTTGGCCTGGAGCGTCTGCCTCCTTGGGCGCGAAGTCTAGAGGACTCTTCCTTCTCACGAGTGCTTGGTCGTCGGTGGTGACATGTCTGACTTTA
TTTCGCGTAGGCCCACGAGTCGCTACGACTCACCTTCCATGATGCCATCGGTTTCTCCAACTCTCAAGGCGCTGCAGGGTACGCTCGCCTTTCAAGCTTAAACTGACGAAGATGATGAAC
TGAGAGGACTCCAGAGGCGGAGGTGCAGATGGCTCCATCATCATCTTTTCCGACCCCGAAGTCCTGTACGACGCCAACGAAGGTATCGACGTCATCGTCGAGCTGCAAAAACCCTTTGTG
GCGCGTCACGCAAACGTAGTCTCCGTCGGTGACTT
GTATGTGTCTTTTCTTCTCTCCGGGCGTCTTCTCTGACAGTGCTGCAGCATCCAACTCGCTGGTGCAATTGGTTTGACCAACTGC
CCCGGTGCACCACGAATCGACTTCTACATGGGCCGACCAAACGCGACCGCGGCGGCGCCAGACAACACCGTCCCGGAGCCATTCC
GTAAGTCAGTTGGTGTACATGTCCGAGTACCGAGT
CTCACAGAACTGCGCGTAGACAATGCGGACCAGATTCTCTCTCGGTTCGCCGACGCAGGGTTCAACGCAGATGAGGTCGTGGCACTGCTCGCGTCTCACAGTGTCGGTGCAGCAGATGTG
GTCGACCACGACCTCCCCGGCTCGCCGTTTGACTCCACGCCCTATCAATTCGACACGCAATTCTACATCGAGACGCAGCTCCGCGGAACCGGTTATCCTGG
GTAAGTCGTCGTGGTCTCT
AGCGTGCGGCGTACTGATGTTTGCCGCATGTAGAACGATCAACCAGGGCCAAGCGAAGAGTCCTGTCGGTGGGGAGATACGTATCGAGTCCGACCAGTTCATTTCGCGCGACCCTCGCAC
CGCATGCGAGTTCCAGTCCATGGCCA
GTACGTCCTTCTCCGCGCATCGTGTCTCTGAATTCGACTGACACTTTCTGCGCGCCAGCCGACCAGGCGAAGATGCAGTCCAAGTTCGCTGCGG
CGATGGTCAAGATGAGCGTGCTCGGGCACACGATCGACAAGCTGACGGACTGCTCCGAGGTGATCCCCACGCCGGCGGCCGTCGCGACGCGCCCCCACCTGCCCGCTGGGAAGCACATGC
GGGATATCGAGCCCGCCTGCAGCGCGACGCCGTACCCGACGCTGACAGCAGACAAAGGCCCAGCGACGACTGTGCAACGCGT
GTACGTGCCTCTACCTTCTCGACGCGTCGATCCTGTTG
CTCACACTTTCCGTCTAGCCCCATCCCAAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCACGTTCAAGGTCCTTTCCTTCGTCGGAGCGCTCGGTGTGGCCAACGCCGCTTTGACGCGCCGCGTTACTTGCCCAGACGGCAAGAACACTGCTGTGAACCCCAAATGCTGC
GCGTTGTACCCCGTCATAGAGGATATCCAAGCCAACCTGTTTGACGGCGGCAAGTGCGACGAAAAC
GCCCACGAGTCGCTACGACTCACCTTCCATGATGCCATCGGTTTCTCCAACTCT
CAAGGCGCTGCAGG
AGGCGGAGGTGCAGATGGCTCCATCATCATCTTTTCCGACCCCGAAGTCCTGTACGACGCCAACGAAGGTATCGACGTCATCGTCGAGCTGCAAAAACCCTTTGTG
GCGCGTCACGCAAACGTAGTCTCCGTCGGTGACTT
CATCCAACTCGCTGGTGCAATTGGTTTGACCAACTGCCCCGGTGCACCACGAATCGACTTCTACATGGGCCGACCAAACGCGACC
GCGGCGGCGCCAGACAACACCGTCCCGGAGCCATTCC
ACAATGCGGACCAGATTCTCTCTCGGTTCGCCGACGCAGGGTTCAACGCAGATGAGGTCGTGGCACTGCTCGCGTCTCACAGT
GTCGGTGCAGCAGATGTGGTCGACCACGACCTCCCCGGCTCGCCGTTTGACTCCACGCCCTATCAATTCGACACGCAATTCTACATCGAGACGCAGCTCCGCGGAACCGGTTATCCTGG
A
ACGATCAACCAGGGCCAAGCGAAGAGTCCTGTCGGTGGGGAGATACGTATCGAGTCCGACCAGTTCATTTCGCGCGACCCTCGCACCGCATGCGAGTTCCAGTCCATGGCCA
CCGACCAG
GCGAAGATGCAGTCCAAGTTCGCTGCGGCGATGGTCAAGATGAGCGTGCTCGGGCACACGATCGACAAGCTGACGGACTGCTCCGAGGTGATCCCCACGCCGGCGGCCGTCGCGACGCGC
CCCCACCTGCCCGCTGGGAAGCACATGCGGGATATCGAGCCCGCCTGCAGCGCGACGCCGTACCCGACGCTGACAGCAGACAAAGGCCCAGCGACGACTGTGCAACGCGT
CCCCATCCCA
AAGTAA

Retrieve as FASTA