Entry information : OsPrx45
Entry ID 1055
Creation 2006-06-23 (Filippo Passardi)
Last sequence changes 2006-06-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx45
Name OsPrx45
Class Class III peroxidase    [Orthogroup: Prx086]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx45
start..stop
S start..stop
HvPrx28 527 0 9..332 11..331
TaPrx44 523 0 9..332 11..331
SbPrx16 516 0 22..332 17..327
TaPrx38 511 0 21..332 22..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14302976..14303200 225 N° 2 14303293..14304066 774  
join(14302976..14303200,14303293..14304066)


exon

Literature and cross-references OsPrx45
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9FRD8
DNA ref. GenBank:   NC_008396.1 (14302976..14304063)
Cluster/Prediction ref. UniGene:   Os.2957
Protein sequence: OsPrx45
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (308)
PWM (Da):   %s   35643.76 (33277.5)  
PI (pH):   %s   5.12 (5.12) Peptide Signal:   %s   cut: 25 range:25-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSPSLPLVTCALLLLLAVACQAHPYWPLELAYYRDKCPQAEAVVKAVVGEAVRQNPGNGAAVIRMLFHDCFVEGCDASILLDPTPFNPTPEKLSAPNNPSMRGFDLIDAIKHAVEAACPGVVSCADIIAFAARDATYFLSGGKVYFDMPSGRRDGTFSNDSGPIDFLPPPTSNLSDLVSSFAVKGLSVEDMVVLSGAHTVGRSHCSSFVPDRLNASVFSDIDGGFAWFLRSQCPLDATPGGNDPTVMLDFVTPNTLDNQYYKNVLDHKVLFTSDAALLTSPETAKMVVDNAVIPGWWEDRFKAAMVKLASIQVKTGYQGQIRKNCRVINY*

Retrieve as FASTA  
Remarks chromosome 3. 48 ESTs and 6 mRNAs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATCACCAAGTCTGCCATTGGTGACGTGTGCCCTGCTGCTGCTGCTGGCCGTGGCATGCCAGGCTCACCCTTACTGGCCACTGGAGTTGGCGTACTACCGCGACAAGTGCCCC
CAGGCCGAGGCCGTCGTCAAGGCCGTCGTCGGGGAGGCCGTCCGCCAGAACCCCGGCAATGGCGCCGCCGTCATCCGCATGCTCTTCCACGACTGCTTTGTCGAG
GTGCGTACGTTAGCT
TCTTCCTCTTCTCCGGCGAGATCGATTGATCGACTTGAGCTATGTGTACTTAGATGTGCATGGTGTTTTGTTGTTAGGGTTGTGATGCTTCGATCCTCCTGGACCCGACGCCGTTCAACC
CGACGCCAGAGAAGCTGAGCGCGCCGAACAACCCGTCCATGCGGGGCTTCGACCTCATCGACGCGATCAAGCACGCCGTGGAGGCGGCGTGCCCGGGCGTCGTCTCGTGCGCCGACATCA
TCGCCTTCGCGGCGCGCGACGCCACCTACTTCCTCAGCGGCGGGAAGGTCTACTTCGACATGCCGTCGGGCCGCCGCGACGGGACCTTCTCCAACGACTCCGGCCCGATCGACTTCCTCC
CGCCGCCGACGTCCAACCTCAGCGACCTCGTCTCCAGCTTCGCCGTCAAGGGCCTCTCCGTGGAGGACATGGTGGTGCTCTCGGGCGCCCACACCGTCGGCCGCTCCCACTGCTCCTCCT
TCGTCCCCGACCGCCTCAACGCCTCCGTCTTCTCCGACATCGACGGCGGCTTCGCCTGGTTCCTCAGGTCGCAGTGCCCGCTCGACGCGACGCCCGGCGGCAACGATCCCACGGTGATGC
TGGACTTCGTGACGCCCAACACGCTGGACAACCAGTACTACAAGAACGTGCTCGACCACAAGGTGCTCTTCACCTCTGACGCGGCGCTCCTGACGTCGCCGGAGACGGCGAAGATGGTGG
TGGACAACGCCGTCATCCCCGGGTGGTGGGAGGACAGGTTCAAGGCGGCCATGGTGAAGTTGGCGAGCATCCAGGTGAAGACCGGGTACCAGGGGCAGATCAGGAAGAACTGCAGGGTCA
TCAACTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATCACCAAGTCTGCCATTGGTGACGTGTGCCCTGCTGCTGCTGCTGGCCGTGGCATGCCAGGCTCACCCTTACTGGCCACTGGAGTTGGCGTACTACCGCGACAAGTGCCCC
CAGGCCGAGGCCGTCGTCAAGGCCGTCGTCGGGGAGGCCGTCCGCCAGAACCCCGGCAATGGCGCCGCCGTCATCCGCATGCTCTTCCACGACTGCTTTGTCGAG
GGTTGTGATGCTTCG
ATCCTCCTGGACCCGACGCCGTTCAACCCGACGCCAGAGAAGCTGAGCGCGCCGAACAACCCGTCCATGCGGGGCTTCGACCTCATCGACGCGATCAAGCACGCCGTGGAGGCGGCGTGC
CCGGGCGTCGTCTCGTGCGCCGACATCATCGCCTTCGCGGCGCGCGACGCCACCTACTTCCTCAGCGGCGGGAAGGTCTACTTCGACATGCCGTCGGGCCGCCGCGACGGGACCTTCTCC
AACGACTCCGGCCCGATCGACTTCCTCCCGCCGCCGACGTCCAACCTCAGCGACCTCGTCTCCAGCTTCGCCGTCAAGGGCCTCTCCGTGGAGGACATGGTGGTGCTCTCGGGCGCCCAC
ACCGTCGGCCGCTCCCACTGCTCCTCCTTCGTCCCCGACCGCCTCAACGCCTCCGTCTTCTCCGACATCGACGGCGGCTTCGCCTGGTTCCTCAGGTCGCAGTGCCCGCTCGACGCGACG
CCCGGCGGCAACGATCCCACGGTGATGCTGGACTTCGTGACGCCCAACACGCTGGACAACCAGTACTACAAGAACGTGCTCGACCACAAGGTGCTCTTCACCTCTGACGCGGCGCTCCTG
ACGTCGCCGGAGACGGCGAAGATGGTGGTGGACAACGCCGTCATCCCCGGGTGGTGGGAGGACAGGTTCAAGGCGGCCATGGTGAAGTTGGCGAGCATCCAGGTGAAGACCGGGTACCAG
GGGCAGATCAGGAAGAACTGCAGGGTCATCAACTACTGA

Retrieve as FASTA