Entry information : PcriCIIBB03
Entry ID 10550
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-06-13 (Catherine Mathe)
Peroxidase information: PcriCIIBB03
Name PcriCIIBB03
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriCIIBB03
start..stop
S start..stop
PcriCIIBB06 630 0 1..364 1..365
PcriCIIBB07 601 0 1..364 1..359
PcriCIIBB05 589 0 1..364 1..358
PoVP04_PC15 539 0 1..364 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1089325..1089385 61 N° 2 1089065..1089269 205 N° 3 1088673..1089008 336 N° 4 1088485..1088610 126
N° 5 1088353..1088422 70 N° 6 1088111..1088297 187 N° 7 1087961..1088057 97 N° 8 1087890..1087902 13
complement(join(1087890..1087902,1087961..1088057,1088111..1088297,1088353..1088 422,1088485..1088610,1088673..1089008,1089065..1089269,1089325..1089385))


exon

Literature and cross-references PcriCIIBB03
DNA ref. JGI genome:   scaffold_5 (1089385..1087890)
Cluster/Prediction ref. JGI gene:   52464
Protein sequence: PcriCIIBB03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (343)
PWM (Da):   %s   38127.68 (35875.5)  
PI (pH):   %s   4 (4.00) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFQVLSAFVFALAAIQATNAALTKRVACPDGNMVTNSACCVLFPIMQDIQANLFDGGECGEDVHESLRLTFHDAIGFSNSLRAMGEFGGGGADGSIVLFDTIETAFHANAGIDDIVDAQKPFIANHTEISPGDFIQFAGAVGVSNCPGAPQLEFFLGRPSAVAASPDLLVPEPFHSVDQILSRFSDAGFTTDEVVALLASHTVAAADLVDPTIPGTPFDSTPEIFDTQFFIETQLRGTGFPGTGGNQGEVESPLAGELRLQSDSLARDSRTACEWQSFVNNQSKLQSAFKSAMVKLSTVGNNINDMIDCSEVIPVPKPVVGVAHLPAGLTLNDIEQACATTPFPTITADPGSETSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). The introns 2 is out of a conserved cintron (extra seq but no other splicing prediction, and confirmed with RNAseq data)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCAGGTCCTCTCCGCCTTTGTGTTCGCACTCGCTGCCATCCAAGCGACCAACGGTAAGACCCAGCTGCTCAGGTGCCGAGTAGCACAATGCTCAATGTTTGCATGCAGCTGC
CCTTACAAAGCGCGTCGCGTGCCCCGATGGCAACATGGTCACCAATTCGGCCTGCTGCGTTTTGTTCCCTATAATGCAAGACATCCAGGCTAACCTGTTCGACGGCGGTGAATGTGGAGA
GGATGTCCACGAGTCCCTCCGCCTCACTTTCCACGATGCCATCGGTTTCTCCAACAGTCTGAGAGCTATGGGCGAATTCGG
GTGCGTATTGTAGTCGACGAAATATTCCACTTCACTGAA
ACAATCTCCTTCATCAGTGGCGGCGGTGCTGACGGCTCAATTGTTCTCTTCGACACCATTGAGACGGCCTTCCATGCCAACGCGGGTATCGACGACATTGTCGATGCACAGAAGCCATTC
ATTGCCAATCACACTGAGATCAGCCCCGGCGACTTTATTCAGTTCGCTGGTGCGGTTGGCGTCTCCAACTGCCCTGGTGCCCCCCAGCTTGAGTTCTTCCTTGGCCGACCCAGCGCTGTC
GCTGCCTCGCCTGACCTGCTCGTGCCGGAGCCGTTCCACTCCGTCGACCAGATCCTCTCGCGGTTCAGTGACGCCGGCTTTACCACCGACGAGGTTGTGGCACTTCTTGCTTC
GTGCGTT
CTTTTTTGTTCTAATAATTTTGCTGTGTAATACTCACCACGTATTTACCATGTAGTCACACTGTCGCTGCAGCCGATCTTGTGGACCCAACTATTCCTGGAACACCTTTCGACTCCACTC
CCGAGATTTTCGACACTCAGTTCTTCATCGAGACACAGCTCCGCGGCACAGGTTTCCCAGG
GTACGGTCAAATCTTCACACTTACCGGATGGTCCGTCTCACTGATACATACTGCTATTG
TAGAACTGGAGGCAACCAGGGAGAGGTCGAGTCGCCCTTGGCCGGAGAGCTTCGTCTCCAATCTGACTCTGAGGTAGCTTTACACCCAGGTGCTGTCGATTTGATACTGACATCTTTTCC
ATCATTAGCTCGCCCGGGACTCGCGCACCGCCTGCGAATGGCAGTCGTTCGTAAACAACCAGTCCAAACTGCAGTCCGCATTCAAGAGTGCCATGGTCAAACTCTCCACTGTCGGAAACA
ACATTAACGACATGATCGATTGCTCGGAGGTCATCCCTGTTCCGAAGCCTGTCGTTGGCGTCGCACACTTGCCCG
GTAAGCGATGCAAATTCCTCCTCGCAGGCCCACAAATTCTTATAA
CGACGTAGCTGGCCTCACGCTGAACGACATCGAACAAGCCTGCGCGACTACCCCCTTCCCGACTATCACAGCCGACCCCGGCTCGGAGACCTCCGTCGCGCCAGTGTACGTCTTGCTTCA
TATGTACTCTCTTTTGCGATGAACTCACATCCGCCCATTACAGACCCCCGTCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCAGGTCCTCTCCGCCTTTGTGTTCGCACTCGCTGCCATCCAAGCGACCAACGCTGCCCTTACAAAGCGCGTCGCGTGCCCCGATGGCAACATGGTCACCAATTCGGCCTGC
TGCGTTTTGTTCCCTATAATGCAAGACATCCAGGCTAACCTGTTCGACGGCGGTGAATGTGGAGAGGATGTCCACGAGTCCCTCCGCCTCACTTTCCACGATGCCATCGGTTTCTCCAAC
AGTCTGAGAGCTATGGGCGAATTCGG
TGGCGGCGGTGCTGACGGCTCAATTGTTCTCTTCGACACCATTGAGACGGCCTTCCATGCCAACGCGGGTATCGACGACATTGTCGATGCACAG
AAGCCATTCATTGCCAATCACACTGAGATCAGCCCCGGCGACTTTATTCAGTTCGCTGGTGCGGTTGGCGTCTCCAACTGCCCTGGTGCCCCCCAGCTTGAGTTCTTCCTTGGCCGACCC
AGCGCTGTCGCTGCCTCGCCTGACCTGCTCGTGCCGGAGCCGTTCCACTCCGTCGACCAGATCCTCTCGCGGTTCAGTGACGCCGGCTTTACCACCGACGAGGTTGTGGCACTTCTTGCT
TC
TCACACTGTCGCTGCAGCCGATCTTGTGGACCCAACTATTCCTGGAACACCTTTCGACTCCACTCCCGAGATTTTCGACACTCAGTTCTTCATCGAGACACAGCTCCGCGGCACAGGT
TTCCCAGG
AACTGGAGGCAACCAGGGAGAGGTCGAGTCGCCCTTGGCCGGAGAGCTTCGTCTCCAATCTGACTCTGAGCTCGCCCGGGACTCGCGCACCGCCTGCGAATGGCAGTCGTTC
GTAAACAACCAGTCCAAACTGCAGTCCGCATTCAAGAGTGCCATGGTCAAACTCTCCACTGTCGGAAACAACATTAACGACATGATCGATTGCTCGGAGGTCATCCCTGTTCCGAAGCCT
GTCGTTGGCGTCGCACACTTGCCCG
CTGGCCTCACGCTGAACGACATCGAACAAGCCTGCGCGACTACCCCCTTCCCGACTATCACAGCCGACCCCGGCTCGGAGACCTCCGTCGCGCCA
GT
ACCCCCGTCCTAG

Retrieve as FASTA