Entry information : PcriCIIBA04
Entry ID 10551
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: PcriCIIBA04
Name PcriCIIBA04
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriCIIBA04
start..stop
S start..stop
ParcCIIBA04 460 2e-163 22..355 26..361
GsppCIIBA04 456 4e-162 4..358 5..361
CuniCIIBA02 453 1e-160 4..358 5..358
PoCIIBA02_C9 449 5e-159 20..357 23..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 510439..510587 149 N° 2 510368..510384 17 N° 3 510283..510299 17 N° 4 510217..510225 9
N° 5 510108..510166 59 N° 6 510038..510051 14 N° 7 509944..509985 42 N° 8 509800..509878 79
N° 9 509508..509748 241 N° 10 509394..509447 54 N° 11 509219..509334 116 N° 12 509137..509165 29
N° 13 508909..509081 173 N° 14 508811..508850 40 N° 15 508736..508760 25 N° 16 508658..508679 22
complement(join(508658..508679,508736..508760,508811..508850,508909..509081,5091 37..509165,509219..509334,509394..509447,509508..509748,509800..509878,509944..5 09985,510038..510051,510108..510166,510217..510225,510283..510299,510368..510384 ,510439..510587))


exon

Literature and cross-references PcriCIIBA04
DNA ref. JGI genome:   scaffold_1 (510587..508658)
Cluster/Prediction ref. JGI gene:   148817
Protein sequence: PcriCIIBA04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (344)
PWM (Da):   %s   38999.9 (37285.0)  
PI (pH):   %s   5.23 (5.23) Peptide Signal:   %s   cut: 18 range:18-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLTCVSLSLLAGLAAAVPSKRASCSKGRTAHDARCCKWFDVLDDIQPNLLSNEGENAHESLRLTFHDAIAYSPKLWKEGKGGGGDGSIMAHSEIETNFHVNQGVDEIVEAQRPFALKHNVSFGDFIQFAGAVAVSNCEGGPRLQFLAGRANESQPSPEFMVPEPSDSVTKILDRMGDAGFSPSEIVDLLASHSVAAQDKVDPSVSTPFDSTFSKFDPQFFVEVMMKGDQYPGNSTHPGEVKAPYEGEFRLQSDFELSRDPRTACEWQSMTDAGSMNRKFEKAMRKLAVLGHNPEDLVDCSEVIPHPKAAKFTPYIPAGKSMADMDHCSAVAMPSLTVQPGPSYSISKVPPAPSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTACTCACCTGCGTCAGCCTTTCGCTCCTTGCCGGCCTCGCTGCGGCAGTACCCTCCAAGAGGGCATCGTGCAGCAAGGGTCGCACTGCTCACGATGCCAGATGCTGCAAGTGGTTC
GATGTCCTAGATGATATACAGCCTAATTT
GTGAGTCCACTCTGGTCGATTGGCAAAATGATAGCTGATAGCCATTGTCCGTAGGCTATCCAACGAGTGCGGTGAATATCTCACCAATTGA
ACTGGCAAGAACCAAAGACAAAGTCGCTAACATCTGATCCGTGACTAGGGGAAAACGCGCACGAGGTACGCATGTTCTGTTCTCTCTATATGTAAATGCTAGACGCTCATAGTTCTCCTT
AGTCTCTACGCGTAAGGCTCTTCGCCGATCAAATAGATCTATGCTAATTTTCCGCGTAAAGCTAACTTTCCACGACGCAATTGCGTACTCCCCGAAATTGTGGAAAGAAGGAAAATTCGG
GTACGTTGGACAATACGCGGGTCAAATTGCATTTTCTAACCGGCATCACTTCTCAGGGGTGGCGGAGCTGGTAAGGAAAGACAGTGTACCGCATCTAGACTTCCTTTGACTCGCATTCGT
AGACGGGTCGATCATGGCGCATTCGGAAATTGAGACCAACTTCCGTAAGTGATCGGCCACTCCGCCACGGAATGAACAGATCGCTAATGTACTCCCCTGGGCCCATCAGACGTGAACCAG
GGCGTCGACGAGATTGTTGAAGCTCAGCGTCCCTTTGCGCTCAAGCACAATGTATCCTTCGGAGATTT
GTGAGCCGTCGTATTTTTCGTTTGTTCTACCGCAGTCTTACGTCTTGGTAGC
ATTCAATTCGCCGGCGCTGTTGCGGTGTCGAACTGCGAAGGTGGACCACGCCTGCAGTTCCTCGCTGGACGCGCAAACGAATCCCAGCCGTCGCCTGAATTCATGGTTCCTGAGCCGAGT
GACTCTGTTACGAAAATCCTCGACCGTATGGGCGACGCAGGGTTCAGCCCTAGCGAAATTGTAGATTTGCTGGCGTCCCATAGCGTCGCTGCACAGGACAAAGTGGACCCATCTGTGCAC
GTAAGCGCTACCTTTGGTTACCGCATTGTGCCCCTTGCTTACGCTCGTTCTGCTGTGCAGTCGACCCCATTCGACTCGACATTCTCTAAATTTGACCCCCAGTTCTTCGTCGAGGTACGT
CGGTATGACAGTCGAGATTGATTTGGTTCGCTCACCTGATCATCACGATCAAGGTGATGATGAAGGGAGACCAATATCCCGGCAACAGCACGCACCCCGGAGAGGTGAAGGCCCCATACG
AAGGCGAATTTAGGCTTCAGTCCGACTTCGAGCTGTCTCGCGACCCACG
GTATGTAAAGTGCAATCACCGCACTGTACGTTATAAGGCTGAAGACTATGCAGAACTGCGTGCGAATGGCA
ATCTATGATCA
GTATGTCACTCACAGTTTTTTCGATCCTGACGCCGTTCTGACAACGCCGATTCAGCCGATGCAGGGTCCATGAACAGGAAATTTGAGAAGGCGATGCGCAAGCTTGCGG
TGCTTGGACACAACCCCGAAGATCTGGTTGACTGCTCCGAGGTCATTCCCCACCCGAAGGCTGCCAAGTTCACGCCGTATATCCCAGCTGGAAAATCGATGGCCGATATGGATCATGCG
G
TGCGCGGATAACCAATTCCCGAAAATGCGACGTGCTAAATTTTCCATTTATTACCAGTGCTCCGCTGTTGCTATGCCCTCTCTCACGGTTCAACCCGGTAAGTTGTAACCCCATTTCCCG
GTTTCTTAACTCTGACTCCGGCTTCAGGCCCGTCCTACTCTATCAGCAAAGTGTACGTGCACACACATATCTTCATCAAATGTTGTCTAACACCGTTCATTATTGCAGTCCGCCTGCGCC
TTCCTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTACTCACCTGCGTCAGCCTTTCGCTCCTTGCCGGCCTCGCTGCGGCAGTACCCTCCAAGAGGGCATCGTGCAGCAAGGGTCGCACTGCTCACGATGCCAGATGCTGCAAGTGGTTC
GATGTCCTAGATGATATACAGCCTAATTT
GCTATCCAACGAGTGCGGGGAAAACGCGCACGAGTCTCTACGCCTAACTTTCCACGACGCAATTGCGTACTCCCCGAAATTGTGGAAAGAA
GGAAAATTCGG
GGGTGGCGGAGCTGACGGGTCGATCATGGCGCATTCGGAAATTGAGACCAACTTCCACGTGAACCAGGGCGTCGACGAGATTGTTGAAGCTCAGCGTCCCTTTGCGCTC
AAGCACAATGTATCCTTCGGAGATTT
CATTCAATTCGCCGGCGCTGTTGCGGTGTCGAACTGCGAAGGTGGACCACGCCTGCAGTTCCTCGCTGGACGCGCAAACGAATCCCAGCCGTCG
CCTGAATTCATGGTTCCTGAGCCGAGTGACTCTGTTACGAAAATCCTCGACCGTATGGGCGACGCAGGGTTCAGCCCTAGCGAAATTGTAGATTTGCTGGCGTCCCATAGCGTCGCTGCA
CAGGACAAAGTGGACCCATCTGTGCAC
TCGACCCCATTCGACTCGACATTCTCTAAATTTGACCCCCAGTTCTTCGTCGAGGTGATGATGAAGGGAGACCAATATCCCGGCAACAGCACG
CACCCCGGAGAGGTGAAGGCCCCATACGAAGGCGAATTTAGGCTTCAGTCCGACTTCGAGCTGTCTCGCGACCCACG
AACTGCGTGCGAATGGCAATCTATGATCACCGATGCAGGGTCC
ATGAACAGGAAATTTGAGAAGGCGATGCGCAAGCTTGCGGTGCTTGGACACAACCCCGAAGATCTGGTTGACTGCTCCGAGGTCATTCCCCACCCGAAGGCTGCCAAGTTCACGCCGTAT
ATCCCAGCTGGAAAATCGATGGCCGATATGGATCATGCG
TGCTCCGCTGTTGCTATGCCCTCTCTCACGGTTCAACCCGGCCCGTCCTACTCTATCAGCAAAGTTCCGCCTGCGCCTTCC
TCGTAG

Retrieve as FASTA