Entry information : PcriCIIBB05
Entry ID 10552
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: PcriCIIBB05
Name PcriCIIBB05
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriCIIBB05
start..stop
S start..stop
PcriCIIBB07 617 0 1..358 1..359
PcriCIIBB03 572 0 1..358 1..364
PcriCIIBB06 567 0 1..358 1..365
PoVP04_PC15 541 0 1..358 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 406611..406671 61 N° 2 406728..406914 187 N° 3 406979..407314 336 N° 4 407377..407502 126
N° 5 407559..407628 70 N° 6 407688..407874 187 N° 7 407938..408034 97 N° 8 408089..408101 13
join(406611..406671,406728..406914,406979..407314,407377..407502,407559..407628, 407688..407874,407938..408034,408089..408101)


exon

Literature and cross-references PcriCIIBB05
DNA ref. JGI genome:   scaffold_3 (406611..408101)
Cluster/Prediction ref. JGI gene:   172282
Protein sequence: PcriCIIBB05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (337)
PWM (Da):   %s   37603.78 (35385.6)  
PI (pH):   %s   4.38 (4.33) Peptide Signal:   %s   cut: 22 range:22-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFQTLAALVFVLGAIQAAKSAVTKTFACADGNRVSNEACCVLFPILDDIQANLFDGGECGEEVHESLRLTFHDAIGFSPELGGGGADGSIVIFDTIETAFHANGGIDDIVDAQKPFIANHSTISVGDFIQFAGAVGVSNCPGAPRLEFLLGRPNATAPSPDLLVPEPFDSVDKILARFKDAGFTTNEVVALLASHTVAAADLVDPTIPGTPFDSTPEVFDTQFFIETQLRGTLFPGNGSNQGEVMSPLAGEIRLQSDSLARDSRTACEWQSMVNNQSKMQSAFKAAMAKLAVVGHNPRSLIDCSEVIPIPKAVTTKAHFPAGLSRRDVQQACLQTPFPTISADPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCAGACCCTCGCCGCTCTCGTCTTCGTCCTCGGTGCAATTCAGGCCGCCAAATGTACGCACAAAATCATACTTTGAAGTCGTGTTTCTCAACGCTTTCATTTGTTTTAGCGG
CCGTGACCAAAACCTTTGCCTGCGCAGATGGCAACAGAGTGTCCAATGAGGCTTGCTGTGTCTTGTTCCCCATCCTGGACGACATACAGGCCAATCTTTTTGATGGCGGGGAATGCGGAG
AAGAGGTCCATGAATCTCTCCGGCTGACCTTCCACGACGCGATCGGTTTCTCGCCTGAGCTGGG
GTAAGGGTGCATCTCGTTTGCATAGACTATAATGTACTCATATTTCACGCGTCGCG
TTATTTAGTGGTGGAGGAGCGGACGGCTCGATCGTCATCTTCGACACCATCGAGACTGCGTTCCACGCAAACGGCGGTATCGACGACATCGTCGACGCCCAAAAGCCATTCATCGCCAAC
CACAGCACGATTAGTGTTGGGGACTTCATCCAGTTTGCCGGCGCCGTCGGTGTCAGCAACTGTCCTGGCGCTCCTCGTCTGGAGTTCTTGCTTGGTCGTCCCAATGCGACCGCCCCCTCG
CCGGACCTTCTCGTCCCAGAGCCATTCGACTCGGTCGACAAGATTCTCGCGCGCTTCAAAGACGCTGGATTCACTACCAACGAGGTCGTTGCGCTTCTAGCCTC
GTACGTATCATACTAC
CAAGTAGTTGCAGCCTGAATCGTATACTGATCACGATGTTATACAGGCATACCGTCGCGGCAGCCGATTTGGTTGACCCAACCATTCCTGGGACACCCTTTGACTCGACGCCTGAGGTTT
TCGACACGCAGTTCTTTATCGAGACTCAGCTTCGCGGCACACTCTTCCCAGG
GTGAGCGAGCCATCCTTGTCTCTGGTGATATCAAGAAATAATAACATAATTTGTAGAAATGGGAGCAA
CCAAGGTGAGGTGATGTCCCCCCTGGCTGGAGAAATTCGCCTCCAATCGGATTCCGAA
GTAAGAAATGCCCTTCCTTTCTATGGGAATATCGCTCTGACCATCTTTCTCGTCTCAAGCTG
GCTCGCGACTCGCGTACAGCGTGCGAGTGGCAGTCAATGGTGAACAACCAGTCGAAGATGCAGTCTGCCTTCAAGGCCGCCATGGCAAAACTTGCCGTAGTGGGGCACAACCCGAGGAGC
CTGATTGACTGCTCCGAGGTCATCCCCATCCCGAAGGCTGTCACCACGAAGGCCCACTTCCCTG
GTATGTGTCAAACACTGCGAGGCTGCACGACGTACATTAATTTAATCGTGGATTGT
ATTATAGCCGGTCTCAGCAGGCGCGACGTCCAGCAAGCGTGCTTGCAGACTCCCTTCCCGACTATCTCTGCGGACCCTGGCCCAGCCACTTCGGTCGCACCTGTGTAAGCGCCTGCATCT
CTTAATCATTTTCCGCATCCTGATCATGACTGCTATAGCCCACCTTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCAGACCCTCGCCGCTCTCGTCTTCGTCCTCGGTGCAATTCAGGCCGCCAAATCGGCCGTGACCAAAACCTTTGCCTGCGCAGATGGCAACAGAGTGTCCAATGAGGCTTGC
TGTGTCTTGTTCCCCATCCTGGACGACATACAGGCCAATCTTTTTGATGGCGGGGAATGCGGAGAAGAGGTCCATGAATCTCTCCGGCTGACCTTCCACGACGCGATCGGTTTCTCGCCT
GAGCTGGG
TGGTGGAGGAGCGGACGGCTCGATCGTCATCTTCGACACCATCGAGACTGCGTTCCACGCAAACGGCGGTATCGACGACATCGTCGACGCCCAAAAGCCATTCATCGCCAAC
CACAGCACGATTAGTGTTGGGGACTTCATCCAGTTTGCCGGCGCCGTCGGTGTCAGCAACTGTCCTGGCGCTCCTCGTCTGGAGTTCTTGCTTGGTCGTCCCAATGCGACCGCCCCCTCG
CCGGACCTTCTCGTCCCAGAGCCATTCGACTCGGTCGACAAGATTCTCGCGCGCTTCAAAGACGCTGGATTCACTACCAACGAGGTCGTTGCGCTTCTAGCCTC
GCATACCGTCGCGGCA
GCCGATTTGGTTGACCCAACCATTCCTGGGACACCCTTTGACTCGACGCCTGAGGTTTTCGACACGCAGTTCTTTATCGAGACTCAGCTTCGCGGCACACTCTTCCCAGG
AAATGGGAGC
AACCAAGGTGAGGTGATGTCCCCCCTGGCTGGAGAAATTCGCCTCCAATCGGATTCCGAA
CTGGCTCGCGACTCGCGTACAGCGTGCGAGTGGCAGTCAATGGTGAACAACCAGTCGAAG
ATGCAGTCTGCCTTCAAGGCCGCCATGGCAAAACTTGCCGTAGTGGGGCACAACCCGAGGAGCCTGATTGACTGCTCCGAGGTCATCCCCATCCCGAAGGCTGTCACCACGAAGGCCCAC
TTCCCTG
CCGGTCTCAGCAGGCGCGACGTCCAGCAAGCGTGCTTGCAGACTCCCTTCCCGACTATCTCTGCGGACCCTGGCCCAGCCACTTCGGTCGCACCTGTCCCACCTTCGTGA

Retrieve as FASTA