Entry information : PcriCIIBB06
Entry ID 10553
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: PcriCIIBB06
Name PcriCIIBB06
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriCIIBB06
start..stop
S start..stop
PcriCIIBB03 632 0 1..365 1..364
PcriCIIBB07 604 0 1..365 1..359
PcriCIIBB05 584 0 1..365 1..358
HanCIIBB07 535 0 1..365 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1080295..1080355 61 N° 2 1080411..1080541 131 N° 3 1080596..1080672 77 N° 4 1080728..1081063 336
N° 5 1081120..1081245 126 N° 6 1081304..1081373 70 N° 7 1081425..1081611 187 N° 8 1081670..1081766 97
N° 9 1081826..1081838 13  
join(1080295..1080355,1080411..1080541,1080596..1080672,1080728..1081063,1081120 ..1081245,1081304..1081373,1081425..1081611,1081670..1081766,1081826..1081838)


exon

Literature and cross-references PcriCIIBB06
DNA ref. JGI genome:   scaffold_5 (1080295..1081838)
Cluster/Prediction ref. JGI gene:   544796
Protein sequence: PcriCIIBB06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (344)
PWM (Da):   %s   38201.78 (35919.6)  
PI (pH):   %s   4.03 (4.03) Peptide Signal:   %s   cut: 22 range:22-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFQVLSTFVFALAAIQATNAALTKRVACPDGVNMVTNAACCVLFPIMEDIQANLFDGGECGEVHESLRLTFHDAIGFSNSMNAAGQFGGGGADGSIVIFDTVETAFHANAGIDDIVDAQKPFINNHTEISVGDFIQFAGAVGVSNCPGAPQLDFFLGRPDAIAASPDLLVPEPFHTVDMILARFADAGFATDEVVALLASHTVAAADLVDPTIPGTPFDSTPEIFDTQFFVETQLRGTLFPGNGSNQGEVMSPLRGEIRLQSDSLARDARTSCEWQSFVGNQAKLQAAFKSAMVKLSTVGHSIPDLVDCSEVIPVPKPVTGTVHLPAGLTLGDIEQSCATTPFPTISADPGPETSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). The introns 3 is out of a conserved cintron (extra seq but no other splicing prediction)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCAGGTGCTCTCCACCTTTGTCTTCGCACTCGCCGCCATTCAGGCGACCAACGGTAGCCATCAACCATTCAGGAATCATGTATTCATATGCTCAATATTTGTCTGCAGCTGC
CCTCACCAAGCGTGTTGCCTGCCCAGATGGGGTCAACATGGTTACCAATGCAGCCTGCTGCGTTTTGTTCCCCATTATGGAGGACATCCAGGCTAACCTCTTTGATGGCGGCGAATGTGG
AGAGGAG
GTAAATCAGCACCTCACCTGCATGTGGTGCTTCGATAAACTAACCACTCCTTAGGTCCACGAGTCTCTTCGCCTCACATTCCACGACGCAATTGGTTTCTCCAACAGCATGAA
CGCCGCAGGTCAATTCGG
GTGGGTGCATCTACCAAAAACACGCTTTCCTCTCCTGACTTTGTTATTTCTTCAGTGGTGGAGGTGCTGACGGATCCATCGTCATCTTCGACACTGTTGAGA
CGGCTTTCCACGCCAACGCGGGTATTGACGATATAGTCGATGCCCAAAAGCCCTTCATCAACAACCACACGGAGATCAGTGTTGGCGACTTCATCCAGTTCGCCGGCGCGGTCGGTGTCT
CCAACTGCCCCGGTGCCCCCCAGCTGGACTTCTTCCTTGGCCGCCCTGATGCCATCGCTGCCTCGCCCGACCTGCTTGTACCGGAGCCATTCCACACTGTGGACATGATTCTTGCAAGGT
TTGCCGACGCAGGCTTCGCCACCGACGAGGTTGTCGCGCTTCTCGCTTC
GTATGTGTTCTTTTACAGTACCAAAAAATAACCATACTGATATGTATCGCATGCAGCCACACTGTCGCTGC
TGCCGACCTTGTAGACCCCACTATCCCGGGAACGCCTTTCGATTCGACTCCTGAGATTTTCGACACACAGTTCTTCGTCGAGACACAGCTTCGTGGCACGCTCTTCCCTGG
GTACGCTCT
CCGTATTATAGTACTTAGGGCTTTTTACTCAACGGCATGCAAAACTCAGAAACGGAAGCAACCAGGGTGAGGTCATGTCACCTCTGCGCGGAGAGATTCGTCTTCAGTCCGACTCCGAGG
TAATTGACATCCTTTTGGTCTCTATTTGCCATTACTGACAAACTATCAAGCTTGCCCGGGACGCGAGGACTTCGTGCGAGTGGCAGTCTTTCGTCGGCAACCAAGCCAAGCTTCAGGCTG
CATTCAAGAGCGCCATGGTCAAACTCTCCACGGTCGGCCACAGCATCCCAGACCTGGTAGACTGCTCCGAAGTCATTCCCGTGCCGAAGCCTGTGACGGGAACGGTCCATTTGCCTG
GTA
ATTGGCACGAATAACCATCACGAGGACTTCCTTGCTAACGGCTTCAATCACACAGCTGGCCTCACGTTGGGCGATATTGAGCAGTCCTGTGCCACCACGCCCTTCCCCACCATCAGTGCC
GACCCTGGGCCAGAGACTTCCGTCGCCCCCGT
GTAAGTTTCAGCCAGTCCTTTTTCCTTGACGCCTTCTGATATTTTGGCCTTCATCACAGACCTCCTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCAGGTGCTCTCCACCTTTGTCTTCGCACTCGCCGCCATTCAGGCGACCAACGCTGCCCTCACCAAGCGTGTTGCCTGCCCAGATGGGGTCAACATGGTTACCAATGCAGCC
TGCTGCGTTTTGTTCCCCATTATGGAGGACATCCAGGCTAACCTCTTTGATGGCGGCGAATGTGGAGAGGAG
GTCCACGAGTCTCTTCGCCTCACATTCCACGACGCAATTGGTTTCTCC
AACAGCATGAACGCCGCAGGTCAATTCGG
TGGTGGAGGTGCTGACGGATCCATCGTCATCTTCGACACTGTTGAGACGGCTTTCCACGCCAACGCGGGTATTGACGATATAGTCGATGCC
CAAAAGCCCTTCATCAACAACCACACGGAGATCAGTGTTGGCGACTTCATCCAGTTCGCCGGCGCGGTCGGTGTCTCCAACTGCCCCGGTGCCCCCCAGCTGGACTTCTTCCTTGGCCGC
CCTGATGCCATCGCTGCCTCGCCCGACCTGCTTGTACCGGAGCCATTCCACACTGTGGACATGATTCTTGCAAGGTTTGCCGACGCAGGCTTCGCCACCGACGAGGTTGTCGCGCTTCTC
GCTTC
CCACACTGTCGCTGCTGCCGACCTTGTAGACCCCACTATCCCGGGAACGCCTTTCGATTCGACTCCTGAGATTTTCGACACACAGTTCTTCGTCGAGACACAGCTTCGTGGCACG
CTCTTCCCTGG
AAACGGAAGCAACCAGGGTGAGGTCATGTCACCTCTGCGCGGAGAGATTCGTCTTCAGTCCGACTCCGAGCTTGCCCGGGACGCGAGGACTTCGTGCGAGTGGCAGTCT
TTCGTCGGCAACCAAGCCAAGCTTCAGGCTGCATTCAAGAGCGCCATGGTCAAACTCTCCACGGTCGGCCACAGCATCCCAGACCTGGTAGACTGCTCCGAAGTCATTCCCGTGCCGAAG
CCTGTGACGGGAACGGTCCATTTGCCTG
CTGGCCTCACGTTGGGCGATATTGAGCAGTCCTGTGCCACCACGCCCTTCCCCACCATCAGTGCCGACCCTGGGCCAGAGACTTCCGTCGCC
CCCGT
ACCTCCTTCTTAA

Retrieve as FASTA