Entry information : HsubCIIBC01
Entry ID 10555
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-10-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-10-29 (Christophe Dunand)
Peroxidase information: HsubCIIBC01
Name HsubCIIBC01
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBC01
start..stop
S start..stop
HsubCIIBC03 619 0 1..359 1..358
HsubCIIBC02 598 0 1..359 1..357
GmarCIIBC09 582 0 1..359 1..359
GmarCIIBC 575 0 1..356 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 157701..157827 127 N° 2 157454..157649 196 N° 3 157338..157403 66 N° 4 156839..157278 440
N° 5 156606..156778 173 N° 6 156468..156545 78  
complement(join(156468..156545,156606..156778,156839..157278,157338..157403,1574 54..157649,157701..157827))


exon

Literature and cross-references HsubCIIBC01
DNA ref. JGI genome:   scaffold_10 (157827..156468)
Cluster/Prediction ref. JGI gene:   132620
Protein sequence: HsubCIIBC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (337)
PWM (Da):   %s   37448.94 (35087.7)  
PI (pH):   %s   4.65 (4.57) Peptide Signal:   %s   cut: 23 range:23-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSTFVALVLGATQIVNAATTKRVTCATGQVTANAACCALFPAVDFIQENLFDGGECGEEAHSALRLSFHDAIGFSIHGGKGGGADGSILAFNSTELEFHANGGIDDIVARQFPVFQGLNLTAGDFVHLAAAVGTANCPGAPQLSFFFGRPPPLAPAPDLTVPEPTDSVTKILERFADAGFSPAEAVALLSSHTIAAADVVDPTIPGTPFDSTVGTFDTQVFLEVLLKGTLFPGNGSQPGEVKSPLAGEMRLQSDFAISQDPRTACLWQLMVDDQKLMMAEFKAAMAKLQVLGQNTRKLIDCSDVVPVPQPFTGHIKFPASFSKKDLQIACPFLPFPSIATVAGPAPTIAPVPGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Incorrect prediction from JGI: last intron is not predicted.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCTCGTCTCAGCACTTTCGTCGCTCTCGTCCTGGGTGCGACCCAGATTGTCAACGCCGCCACTACCAAGCGTGTGACGTGCGCGACTGGACAAGTTACCGCAAACGCTGCC
TGCTGCG
GTCAGTGAAATTGCAGCTTCACTTGTTGTTTTTGTTCTCATTCGTTTTTAGCGCTCTTCCCTGCTGTCGATTTTATCCAGGAGAACCTGTTCGACGGCGGCGAGTGCGGTGAG
GAAGCCCACTCTGCCCTTCGTCTCTCCTTCCACGATGCCATCGGCTTCTCCATCCACGGAGGAAAGGGAGGAGGCGCCGACGGTTCCATCCTCGCCTTCAACTCCACTGAGCTCGAGTTC
CACGCCAACGGAGG
GTGAGGATTACCTTCACATGCACGACTCTAACGCTTACTTTTCAACATAGTATTGACGACATTGTCGCTCGCCAATTCCCTGTTTTCCAAGGGCTGAACCTCACCG
CTGGTGACTT
GTAAGTTTCATTTATAAGGATCCCTTCAAAGTCCAAGCCAACTAAACCTTCAATTTCAGCGTCCACCTCGCCGCCGCTGTCGGCACCGCCAACTGCCCCGGTGCCCCGCA
ACTGAGCTTCTTCTTTGGCCGCCCCCCGCCGCTCGCGCCCGCGCCCGATCTCACCGTCCCGGAGCCAACTGACAGCGTCACCAAGATCCTCGAGCGCTTCGCCGACGCGGGATTCTCGCC
CGCCGAGGCTGTTGCTCTGCTCTCGTCCCACACCATCGCTGCAGCGGACGTCGTCGACCCAACCATCCCGGGCACGCCCTTCGACTCTACCGTCGGTACATTCGACACCCAGGTGTTCCT
CGAGGTTCTGCTGAAGGGAACGCTCTTCCCCGGAAACGGTTCGCAGCCTGGCGAGGTGAAGTCGCCTCTGGCCGGAGAGATGCGCTTGCAGTCCGACTTCGCTATCTCTCAGGACCCGCG
GACCGCCTGCCTCTGGCAGTTGATGGTTG
GTGCGTATATTTCTTCTTGCCGGTCATTGGCATAGTATTGATGTTTTGTTAAATCCACAGACGATCAGAAACTCATGATGGCCGAGTTTAA
GGCTGCGATGGCCAAGCTCCAAGTTCTCGGCCAGAACACAAGGAAATTGATCGACTGCTCTGATGTTGTTCCCGTTCCCCAGCCTTTCACCGGCCACATCAAGTTCCCTGCCAGCTTCTC
GAAGAAGGACCTCCAAATTGCC
GTGAGTAGCTTTAACGTCTCATTCTCTTTGATTTCTTTACAAAACTAACTCTTTGTTAAGTGCCCCTTCCTGCCGTTCCCCAGCATTGCCACCGTAGC
AGGTCCTGCCCCCACTATCGCACCTGTTCCTGGCTCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCTCGTCTCAGCACTTTCGTCGCTCTCGTCCTGGGTGCGACCCAGATTGTCAACGCCGCCACTACCAAGCGTGTGACGTGCGCGACTGGACAAGTTACCGCAAACGCTGCC
TGCTGCG
CGCTCTTCCCTGCTGTCGATTTTATCCAGGAGAACCTGTTCGACGGCGGCGAGTGCGGTGAGGAAGCCCACTCTGCCCTTCGTCTCTCCTTCCACGATGCCATCGGCTTCTCC
ATCCACGGAGGAAAGGGAGGAGGCGCCGACGGTTCCATCCTCGCCTTCAACTCCACTGAGCTCGAGTTCCACGCCAACGGAGG
TATTGACGACATTGTCGCTCGCCAATTCCCTGTTTTC
CAAGGGCTGAACCTCACCGCTGGTGACTT
CGTCCACCTCGCCGCCGCTGTCGGCACCGCCAACTGCCCCGGTGCCCCGCAACTGAGCTTCTTCTTTGGCCGCCCCCCGCCGCTCGCGCCC
GCGCCCGATCTCACCGTCCCGGAGCCAACTGACAGCGTCACCAAGATCCTCGAGCGCTTCGCCGACGCGGGATTCTCGCCCGCCGAGGCTGTTGCTCTGCTCTCGTCCCACACCATCGCT
GCAGCGGACGTCGTCGACCCAACCATCCCGGGCACGCCCTTCGACTCTACCGTCGGTACATTCGACACCCAGGTGTTCCTCGAGGTTCTGCTGAAGGGAACGCTCTTCCCCGGAAACGGT
TCGCAGCCTGGCGAGGTGAAGTCGCCTCTGGCCGGAGAGATGCGCTTGCAGTCCGACTTCGCTATCTCTCAGGACCCGCGGACCGCCTGCCTCTGGCAGTTGATGGTTG
ACGATCAGAAA
CTCATGATGGCCGAGTTTAAGGCTGCGATGGCCAAGCTCCAAGTTCTCGGCCAGAACACAAGGAAATTGATCGACTGCTCTGATGTTGTTCCCGTTCCCCAGCCTTTCACCGGCCACATC
AAGTTCCCTGCCAGCTTCTCGAAGAAGGACCTCCAAATTGCC
TGCCCCTTCCTGCCGTTCCCCAGCATTGCCACCGTAGCAGGTCCTGCCCCCACTATCGCACCTGTTCCTGGCTCATAG

Retrieve as FASTA