Entry information : HsubCIIBC02
Entry ID 10556
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Christophe Dunand)
Peroxidase information: HsubCIIBC02
Name HsubCIIBC02
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBC02
start..stop
S start..stop
HsubCIIBC03 603 0 1..357 1..358
GmarCIIBC06 584 0 1..354 1..354
HsubCIIBC04 577 0 1..357 1..357
HsubCIIBC01 576 0 1..357 1..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 98106..98232 127 N° 2 97852..98047 196 N° 3 97733..97798 66 N° 4 97406..97678 273
N° 5 97186..97352 167 N° 6 96884..97128 245  
complement(join(96884..97128,97186..97352,97406..97678,97733..97798,97852..98047 ,98106..98232))


exon

Literature and cross-references HsubCIIBC02
DNA ref. JGI genome:   scaffold_24 (98232..96884)
Cluster/Prediction ref. JGI gene:   86525
Protein sequence: HsubCIIBC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (335)
PWM (Da):   %s   36972.5 (34726.3)  
PI (pH):   %s   4.72 (4.62) Peptide Signal:   %s   cut: 23 range:23-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSTVVALALSAATLSNAALTKRITCATGQTTANAACCPLFSAVEFLQTNLFDGGECGEEAHSALRLSFHDAIGFSIHGGKGGGADGSILAFNSTELEFHANGGIDDIVARQFPVFEGLNLTAGDFVHLAAAVGTANCPGAPRLQFMFGRPPPVAPAPDLTVPEPTDSVTKILARFADAGFSPQEAVALLSSHTIAAADVVDPTIPGTPFDSTVGTFDSQVFLEVLLKGSLFPGNGSQPGEVLSPLHGEMRLQSDFAISQDPRTACFWQDMINNQARMMSEFKAAMAKLQVLGQPRLIDCSDVVPVPAPFAGPIKFPASFSQKDVQVACHASAFPSIATVAGPAPTVAPVPGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCCCGACTTTCGACAGTTGTCGCCCTCGCCCTGAGCGCAGCCACTCTTTCTAACGCGGCACTCACAAAGCGCATTACATGTGCCACAGGACAAACGACAGCTAACGCTGCT
TGCTGCC
GTCAGTCTTAGTGTTAATTGACCTAGTTTTATATACTTACGCGTCACCAAAACTCAAGCATTGTTTTCGGCGGTTGAATTCCTCCAGACCAACCTGTTTGATGGCGGTGAATG
CGGCGAGGAAGCCCACTCTGCTCTTCGTCTGTCCTTCCACGATGCCATTGGTTTCTCCATTCACGGAGGAAAGGGTGGAGGAGCCGATGGATCCATCCTCGCTTTTAACTCCACTGAGCT
GGAATTCCATGCTAACGGAGG
GTATGTGTTAAATTTTATGTGCGGTATTACATGCTAATTTATTTTGCACAAAGCATCGACGATATCGTGGCGCGCCAATTCCCGGTATTTGAGGGCCTC
AATTTGACTGCGGGTGACTT
GTGAGCAGTTCGGACGATAATGCTGCTATTCATGACGCTAATTCCACTTTTCAGTGTGCACCTCGCCGCGGCTGTCGGCACTGCTAACTGCCCGGGTGCT
CCTCGTCTCCAATTTATGTTTGGCCGCCCACCACCGGTCGCCCCTGCTCCTGATTTGACCGTCCCAGAGCCAACCGATAGCGTTACAAAGATCCTTGCACGTTTCGCAGACGCCGGCTTC
TCTCCTCAAGAAGCGGTTGCCTTGCTCTCTTCCCACACCATCGCTGCAGCGGACGTTGTCGACCCAACTATTCCTGGAACTCCCTTCGACTCTACTGTCGGAACCTT
GTAAGGGGTTATT
GATGCACTGAAGACCAAAATTGATACCAATTATTCTTTAGCGATTCCCAAGTTTTCCTTGAGGTACTTCTCAAAGGTAGCCTGTTCCCCGGCAATGGCTCTCAGCCCGGCGAGGTCCTCT
CTCCTCTTCACGGAGAGATGCGTCTCCAGTCCGACTTTGCCATCTCGCAAGATCCTCGCACGGCCTGCTTCTGGCAAGACATGATCA
GTATGCATACGTCATTCTATTGGTTGTTCGAAA
TGCTCACCTTTATTACCTTCACAGACAACCAGGCCCGCATGATGTCCGAGTTCAAGGCAGCAATGGCTAAGCTCCAAGTTCTCGGACAGCCCAGACTGATTGACTGCTCTGACGTTGTCC
CCGTCCCGGCACCGTTCGCTGGACCAATCAAATTCCCCGCAAGCTTCTCGCAGAAGGATGTCCAGGTTGCATGCCATGCTTCCGCCTTCCCCAGCATTGCTACTGTTGCTGGGCCTGCTC
CCACCGTCGCTCCCGTCCCAGGATCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCCCGACTTTCGACAGTTGTCGCCCTCGCCCTGAGCGCAGCCACTCTTTCTAACGCGGCACTCACAAAGCGCATTACATGTGCCACAGGACAAACGACAGCTAACGCTGCT
TGCTGCC
CATTGTTTTCGGCGGTTGAATTCCTCCAGACCAACCTGTTTGATGGCGGTGAATGCGGCGAGGAAGCCCACTCTGCTCTTCGTCTGTCCTTCCACGATGCCATTGGTTTCTCC
ATTCACGGAGGAAAGGGTGGAGGAGCCGATGGATCCATCCTCGCTTTTAACTCCACTGAGCTGGAATTCCATGCTAACGGAGG
CATCGACGATATCGTGGCGCGCCAATTCCCGGTATTT
GAGGGCCTCAATTTGACTGCGGGTGACTT
TGTGCACCTCGCCGCGGCTGTCGGCACTGCTAACTGCCCGGGTGCTCCTCGTCTCCAATTTATGTTTGGCCGCCCACCACCGGTCGCCCCT
GCTCCTGATTTGACCGTCCCAGAGCCAACCGATAGCGTTACAAAGATCCTTGCACGTTTCGCAGACGCCGGCTTCTCTCCTCAAGAAGCGGTTGCCTTGCTCTCTTCCCACACCATCGCT
GCAGCGGACGTTGTCGACCCAACTATTCCTGGAACTCCCTTCGACTCTACTGTCGGAACCTT
CGATTCCCAAGTTTTCCTTGAGGTACTTCTCAAAGGTAGCCTGTTCCCCGGCAATGGC
TCTCAGCCCGGCGAGGTCCTCTCTCCTCTTCACGGAGAGATGCGTCTCCAGTCCGACTTTGCCATCTCGCAAGATCCTCGCACGGCCTGCTTCTGGCAAGACATGATCA
ACAACCAGGCC
CGCATGATGTCCGAGTTCAAGGCAGCAATGGCTAAGCTCCAAGTTCTCGGACAGCCCAGACTGATTGACTGCTCTGACGTTGTCCCCGTCCCGGCACCGTTCGCTGGACCAATCAAATTC
CCCGCAAGCTTCTCGCAGAAGGATGTCCAGGTTGCATGCCATGCTTCCGCCTTCCCCAGCATTGCTACTGTTGCTGGGCCTGCTCCCACCGTCGCTCCCGTCCCAGGATCATGA

Retrieve as FASTA