Entry information : HsubCIIBC03
Entry ID 10559
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-05-24 (Nizar Fawal)
Peroxidase information: HsubCIIBC03
Name HsubCIIBC03
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBC03
start..stop
S start..stop
HsubCIIBC02 603 0 1..358 1..357
HsubCIIBC01 597 0 1..358 1..359
GmarCIIBC09 593 0 1..358 1..359
GmarCIIBC 580 0 1..355 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 68205..68328 124 N° 2 67952..68147 196 N° 3 67827..67892 66 N° 4 67495..67767 273
N° 5 67274..67440 167 N° 6 67046..67218 173 N° 7 66917..66994 78  
complement(join(66917..66994,67046..67218,67274..67440,67495..67767,67827..67892 ,67952..68147,68205..68328))


exon

Literature and cross-references HsubCIIBC03
DNA ref. JGI genome:   scaffold_57 (68328..66917)
Cluster/Prediction ref. JGI gene:   167926
Protein sequence: HsubCIIBC03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (337)
PWM (Da):   %s   37119.72 (34935.5)  
PI (pH):   %s   4.61 (4.54) Peptide Signal:   %s   cut: 22 range:22-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFARLSAIVALALAASQVNAALTKRVTCASGHVTANAACCALFPAVDFLQENLFDGGECGEEAHSALRLSFHDAIGFSIHGGKGGGADGSILAFNSTELEFHANGGIDDIVARQFPVFEGLTLSAGDFVHLAAAVGTANCPGAPRLEFFFGRPAPLAPAPDLTVPEPTDSVTKILARFADAGFSPAEAVALLSSHTIAAADVVDITIPGTPFDSTVGTFDTQVFLEVLLKGTAFPGNGSQAGEVLSPLAGEMRLQSDFAISQDPRTACLWQAMVNDQERMMSEFKAAMAKLQVLGQNTRRLVDCSDVVPVPAPFAGPIKFPASFSSKDLQLACKELRFPNIATVAGPAPTVAPVPGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCGCTCGCCTTTCAGCAATCGTCGCACTTGCTCTTGCAGCATCCCAAGTCAACGCCGCCCTCACCAAGCGCGTTACTTGTGCGTCCGGACATGTAACTGCAAACGCTGCTTGC
TGTG
GTCAGTTACTGTTGCACCGCATGCTCATTCCACCTCTCACAATTTTTCTCGATGTAGCGCTGTTCCCTGCCGTCGATTTCTTGCAAGAGAACCTTTTTGATGGTGGTGAATGCGGT
GAAGAGGCTCACTCCGCTCTCCGCCTTTCCTTCCACGACGCCATCGGATTCTCCATCCATGGCGGAAAGGGAGGAGGTGCAGACGGCTCAATCCTCGCGTTCAACTCAACTGAGCTGGAG
TTCCATGCAAACGGAGG
GTGAGATATATCCCTGTCCCGACGAATATTCAGACCAGAACCTAACCTCAAACTCTTAGAATTGACGATATCGTCGCGAGACAATTCCCCGTCTTTGAAGGGT
TGACTTTGAGCGCAGGTGACTT
GTGAGTTCTTCTCGATGACAATAGAACTATATCGCGATCGTTCTAATTCTACGCGTCAGTGTTCACCTTGCGGCTGCAGTTGGCACTGCCAATTGCCC
TGGTGCACCTCGCCTGGAATTCTTTTTCGGCAGGCCCGCACCACTCGCCCCCGCCCCTGATCTGACAGTCCCCGAGCCCACGGACAGCGTTACCAAAATTCTGGCCCGCTTCGCTGACGC
TGGGTTCTCCCCAGCCGAGGCTGTGGCGCTTCTCTCTTCTCACACCATCGCTGCAGCTGACGTTGTGGATATTACCATCCCGGGAACTCCATTCGATTCCACCGTCGGAACCTT
GTAAGC
AGTCCTCTAAATTACACGCTATTTGCTGAATACAAATATCTTCCACAGTGATACTCAAGTCTTCCTCGAGGTTCTCCTCAAGGGCACCGCATTCCCTGGAAACGGCTCGCAAGCTGGCGA
AGTCCTTTCTCCCCTCGCCGGTGAAATGCGCCTTCAGAGCGACTTCGCCATTTCACAGGACCCAAGGACGGCTTGCCTCTGGCAGGCCATGGTCA
GTGAGTGGCGGATATACTTGATTGT
GTGATCATCGTTTAATTTTAAATTGCGCAGACGACCAGGAGCGCATGATGTCCGAATTCAAGGCTGCCATGGCCAAGCTCCAGGTTCTCGGCCAGAACACCCGCAGGCTCGTCGACTGCT
CTGACGTTGTTCCCGTTCCGGCCCCATTCGCCGGCCCCATCAAGTTCCCAGCCAGCTTTTCGAGCAAGGATCTCCAACTTGCT
GTGAGTACGATCAACACAGCAAAATGATCAACGTTTA
ATTTTCCTCAATAGTGCAAGGAGCTGAGGTTCCCTAATATTGCGACCGTCGCTGGTCCCGCCCCGACTGTCGCCCCTGTTCCGGGATCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCGCTCGCCTTTCAGCAATCGTCGCACTTGCTCTTGCAGCATCCCAAGTCAACGCCGCCCTCACCAAGCGCGTTACTTGTGCGTCCGGACATGTAACTGCAAACGCTGCTTGC
TGTG
CGCTGTTCCCTGCCGTCGATTTCTTGCAAGAGAACCTTTTTGATGGTGGTGAATGCGGTGAAGAGGCTCACTCCGCTCTCCGCCTTTCCTTCCACGACGCCATCGGATTCTCCATC
CATGGCGGAAAGGGAGGAGGTGCAGACGGCTCAATCCTCGCGTTCAACTCAACTGAGCTGGAGTTCCATGCAAACGGAGG
AATTGACGATATCGTCGCGAGACAATTCCCCGTCTTTGAA
GGGTTGACTTTGAGCGCAGGTGACTT
TGTTCACCTTGCGGCTGCAGTTGGCACTGCCAATTGCCCTGGTGCACCTCGCCTGGAATTCTTTTTCGGCAGGCCCGCACCACTCGCCCCCGCC
CCTGATCTGACAGTCCCCGAGCCCACGGACAGCGTTACCAAAATTCTGGCCCGCTTCGCTGACGCTGGGTTCTCCCCAGCCGAGGCTGTGGCGCTTCTCTCTTCTCACACCATCGCTGCA
GCTGACGTTGTGGATATTACCATCCCGGGAACTCCATTCGATTCCACCGTCGGAACCTT
TGATACTCAAGTCTTCCTCGAGGTTCTCCTCAAGGGCACCGCATTCCCTGGAAACGGCTCG
CAAGCTGGCGAAGTCCTTTCTCCCCTCGCCGGTGAAATGCGCCTTCAGAGCGACTTCGCCATTTCACAGGACCCAAGGACGGCTTGCCTCTGGCAGGCCATGGTCA
ACGACCAGGAGCGC
ATGATGTCCGAATTCAAGGCTGCCATGGCCAAGCTCCAGGTTCTCGGCCAGAACACCCGCAGGCTCGTCGACTGCTCTGACGTTGTTCCCGTTCCGGCCCCATTCGCCGGCCCCATCAAG
TTCCCAGCCAGCTTTTCGAGCAAGGATCTCCAACTTGCT
TGCAAGGAGCTGAGGTTCCCTAATATTGCGACCGTCGCTGGTCCCGCCCCGACTGTCGCCCCTGTTCCGGGATCTTAG

Retrieve as FASTA