Entry information : HsubCIIBB01
Entry ID 10560
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-03-26 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: HsubCIIBB01
Name HsubCIIBB01
Class Other class II peroxidase type B    [Orthogroup: CIIBB002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBB01
start..stop
S start..stop
HsubCIIBB02 564 0 1..365 1..365
HsubCIIBB03 561 0 1..365 1..365
HsubCIIBB09 560 0 1..362 1..362
HsubCIIBB10 560 0 1..365 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9296..9356 61 N° 2 9410..9596 187 N° 3 9651..9791 141 N° 4 9844..10089 246
N° 5 10142..10176 35 N° 6 10232..10280 49 N° 7 10334..10403 70 N° 8 10457..10502 46
N° 9 10559..10635 77 N° 10 10692..10790 99 N° 11 10841..10880 40 N° 12 10936..10960 25
N° 13 11017..11038 22  
join(9296..9356,9410..9596,9651..9791,9844..10089,10142..10176,10232..10280,1033 4..10403,10457..10502,10559..10635,10692..10790,10841..10880,10936..10960,11017. .11038)


exon

Literature and cross-references HsubCIIBB01
DNA ref. JGI genome:   scaffold_57 (9296..10958)
Cluster/Prediction ref. JGI gene:   43989
Protein sequence: HsubCIIBB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (344)
PWM (Da):   %s   37521.04 (35409.8)  
PI (pH):   %s   4.29 (4.23) Peptide Signal:   %s   cut: 22 range:22-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSRALSALVLALPLLSVSALRTKRALCPDGVNSAVNQACCALFPVVADLTENLFDNECGDAAHGALRLVFHDAIGISPTLGGGGADGSIFTFSTTELTFHANIGIDDVLDQVGPFITKYADVLSPGDFIQLAGAVSLTQCPGAPRIPFVMGRPQPIAASPPGLVPEPFDNITSILQRFGEVGFSPAEVVAVVGGSHSVAGADDIVPNQQGVPFDQTPSLFTQIFVDVLLRGTNFTDGQGAQQGESETAVAGTVRLQSDGLARDPRTACTWQSFVNQQSQLSTAFGQGVTKLSLLGQTASLVDCSEVIPKAIAFTGGAATLPPGQTLQDIQASCPTAAFPKLATQPGPATTVSPIPQATDS

Retrieve as FASTA  
Remarks Complete sequenc e from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAGTCGCGCGCTCTCTGCTCTTGTCCTAGCACTGCCCCTGCTTTCTGTCAGCGGTATGTTTATTTCATGTTCATAAAAAAAATCCAGGGTACTCATTATTTTTTAGCCCTTA
GAACCAAGCGCGCTCTTTGTCCCGATGGAGTGAACTCCGCTGTGAACCAGGCGTGCTGCGCTCTGTTTCCTGTTGTCGCGGATTTGACAGAGAACTTGTTTGATAATGAATGTGGCGACG
CTGCTCATGGAGCTCTTCGTCTCGTGTTCCACGACGCTATTGGAATATCTCCCACTTTGGG
GTACGTGCCATACGTTTTTCCTACTACAATAAATGACTGAATAAATGTGAACAGTGGTG
GAGGGGCTGACGGCTCCATCTTCACCTTCAGCACGACTGAGCTCACCTTCCATGCCAACATCGGTATAGATGATGTTCTTGACCAAGTCGGACCTTTCATCACAAAATACGCCGACGTGC
TGAGCCCCGGAGACTT
GTGAGTATCCGTTATTTCTAATTTCACCACCAATTGAAGTCTTTTCCCGTAGCATCCAACTTGCCGGTGCCGTCAGTCTTACTCAGTGCCCCGGAGCTCCCCGT
ATTCCATTTGTGATGGGGCGCCCGCAACCTATCGCCGCATCACCTCCTGGTCTCGTTCCTGAGCCATTCGACAACATTACCAGCATCCTCCAGCGCTTCGGTGAAGTCGGCTTCTCCCCT
GCAGAGGTTGTAGCCGTCGTCGGTGGATCACACAGTGTTGCTGGAGCAGACGACATTGTCCCGAACCAACAAGG
GTATGGATTGTCAAACAATTCAACACATCGTTATACTAACTAAATT
ATGTAGAGTTCCTTTCGATCAGACCCCTTCCCTGTTCGATAGTGAGCTCTCACTCTGTGTCACATCATATGTTCTGCGTCGCTAATATATTTATAGCTCAAATCTTCGTTGATGTCCTGC
TGCGCGGCACCAACTTCACCGACGG
GTTTGTTACTATGTTTTTCAAGGTGCTACTTCTTGCTGAATAACATATCTTAGCCAAGGTGCTCAGCAAGGTGAATCCGAGACTGCCGTTGCGGG
TACTGTGCGCCTCCAGTCCGACGGCCTT
GTAAGTTGATTCGTCTCTTATGCGTAAATTACCTGATTTACTCTAATCTGTAGCTGGCCCGGGATCCCAGAACCGCCTGCACTTGGCAATCG
TTCGTCA
GTGAGTAATATTTTCACATTTTCTCACCAACATAGGTTTAACTATGTCGACTGTAGACCAGCAATCGCAATTGTCTACTGCTTTCGGACAAGGAGTCACTAAGCTTTCCCTCC
TCGGCCAGACCGCAAGCAAG
GTATGAAGATATACCGATAAGGCAATCAAGATTATTCATGTATTACTTTTTTTCAGCTGGTCGATTGCAGCGAAGTTATTCCCAAAGCCATTGCATTCAC
CGGCGGCGCCGCCACCCTTCCCCCAGGCCAGACCCTCCAGGATATCCAGGCTTCG
GTAAGCATGATTTTCTCCGAGACTGGATTCAATATTTACATTCTTCATAGTGCCCTACTGCTGCG
TTCCCCAAGCTTGCTACTCAACCAG
GTATGTATCACGCTCTCGGAAATGCATACATACTTCATTACTGACATAATTCTAGGCCCTGCCACAACTGTCTCCCCAATGTAAGCTGATTTTGA
GACTAATAATGTGCGCTTCTCAACTAACCCATGCTTTTTAGCCCCCAGGCCACCGACTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAGTCGCGCGCTCTCTGCTCTTGTCCTAGCACTGCCCCTGCTTTCTGTCAGCGCCCTTAGAACCAAGCGCGCTCTTTGTCCCGATGGAGTGAACTCCGCTGTGAACCAGGCG
TGCTGCGCTCTGTTTCCTGTTGTCGCGGATTTGACAGAGAACTTGTTTGATAATGAATGTGGCGACGCTGCTCATGGAGCTCTTCGTCTCGTGTTCCACGACGCTATTGGAATATCTCCC
ACTTTGGG
TGGTGGAGGGGCTGACGGCTCCATCTTCACCTTCAGCACGACTGAGCTCACCTTCCATGCCAACATCGGTATAGATGATGTTCTTGACCAAGTCGGACCTTTCATCACAAAA
TACGCCGACGTGCTGAGCCCCGGAGACTT
CATCCAACTTGCCGGTGCCGTCAGTCTTACTCAGTGCCCCGGAGCTCCCCGTATTCCATTTGTGATGGGGCGCCCGCAACCTATCGCCGCA
TCACCTCCTGGTCTCGTTCCTGAGCCATTCGACAACATTACCAGCATCCTCCAGCGCTTCGGTGAAGTCGGCTTCTCCCCTGCAGAGGTTGTAGCCGTCGTCGGTGGATCACACAGTGTT
GCTGGAGCAGACGACATTGTCCCGAACCAACAAGG
AGTTCCTTTCGATCAGACCCCTTCCCTGTTCGATACTCAAATCTTCGTTGATGTCCTGCTGCGCGGCACCAACTTCACCGACGGC
CAAGGTGCTCAGCAAGGTGAATCCGAGACTGCCGTTGCGGGTACTGTGCGCCTCCAGTCCGACGGCCTT
CTGGCCCGGGATCCCAGAACCGCCTGCACTTGGCAATCGTTCGTCAACCAG
CAATCGCAATTGTCTACTGCTTTCGGACAAGGAGTCACTAAGCTTTCCCTCCTCGGCCAGACCGCAAGCAAG
CTGGTCGATTGCAGCGAAGTTATTCCCAAAGCCATTGCATTCACCGGC
GGCGCCGCCACCCTTCCCCCAGGCCAGACCCTCCAGGATATCCAGGCTTCG
TGCCCTACTGCTGCGTTCCCCAAGCTTGCTACTCAACCAGGCCCTGCCACAACTGTCTCCCCAATCCCC
CAGGCCACCGACTCTTAG

Retrieve as FASTA