Entry information : HsubCIIBB06
Entry ID 10561
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: HsubCIIBB06
Name HsubCIIBB06
Class Other class II peroxidase type B    [Orthogroup: CIIBB002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBB06
start..stop
S start..stop
HsubCIIBB04 623 0 1..364 1..364
HsubCIIBB07 586 0 1..365 1..365
HsubCIIBB08 582 0 1..362 1..361
HsubCIIBB09 559 0 1..363 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42042..42102 61 N° 2 41860..41987 128 N° 3 41748..41806 59 N° 4 41548..41688 141
N° 5 41241..41489 249 N° 6 41146..41180 35 N° 7 41044..41089 46 N° 8 40918..40987 70
N° 9 40816..40861 46 N° 10 40677..40753 77 N° 11 40520..40618 99 N° 12 40404..40468 65
N° 13 40316..40346 31  
complement(join(40316..40346,40404..40468,40520..40618,40677..40753,40816..40861 ,40918..40987,41044..41089,41146..41180,41241..41489,41548..41688,41748..41806,4 1860..41987,42042..42102))


exon

Literature and cross-references HsubCIIBB06
DNA ref. JGI genome:   scaffold_130 (42102..40316)
Cluster/Prediction ref. JGI gene:   220069
Protein sequence: HsubCIIBB06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369 (347)
PWM (Da):   %s   38090.9 (35934.7)  
PI (pH):   %s   3.92 (3.94) Peptide Signal:   %s   cut: 22 range:22-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFSAALSALALSLPLLSVNALRTRRALCPDGVNTAINLACCSLFPVVQDIQENFLTNECGDAHGALRLVFHDAIGISPTAGGGGADGSIATFNETELTFPANLGIDDILDEIGPFLLKHSNTMSPGDFIQLAGALSLVQCPGAPRIPFFMGRAQPKAASPPNLVPQPFDSVASIVQRFGEVGFTTPEEIVAVVGGSHSVAGADDVVPGLQGLPFDQTPSVFTQIFVDVQLRGTIFTGQGGNQGETETSVLGTVRLQSDHLARDSQTNCAWQSFANNQAAMAEAFGQGVLKLSLLGQNQDLTDCSEVIPAAIPFTGGPATLPPGLTMNDIEQACATAAFPSLATQPGPATSVPAIPQADDDDDS

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCAGCGCTGCTCTATCCGCTCTCGCTCTCTCTCTTCCTCTTCTGTCTGTCAATGGTGCGTCCAGCCTAGATAATCTCCGAGTCTACAATTTCCTCATTGTTCTTACAGCACTC
AGGACGAGGCGGGCTTTGTGCCCGGATGGTGTCAACACTGCCATTAACCTAGCGTGTTGCTCTCTGTTCCCGGTGGTCCAAGACATACAGGAGAATTTTCTTACAAATGAATGCGGCGAC
AGT
GTAAGTTTTTCTCTGTATTCGACATACAAGTCCAGAGGTTGACATTTGTACAGGCTCACGGTGCTCTTCGCCTCGTCTTCCACGATGCTATTGGTATTTCTCCTACGGCAGGGTAAG
TTCATTTTTTATTTTTGAAACAACAGCATATGATCCTAATACGCAAATATGCAGGGGTGGAGGAGCTGACGGCTCTATTGCAACCTTCAATGAAACTGAGCTAACCTTCCCTGCCAACCT
TGGTATCGATGACATCCTCGACGAGATTGGCCCATTCCTCCTAAAGCACTCTAACACAATGAGCCCCGGTGACTT
GTACGAGTTTCTGTACCAATATGAATTCCTGTACATGTATTCACT
GAATATTTAACAGCATTCAGCTCGCCGGTGCACTCAGTCTCGTGCAATGCCCGGGTGCCCCTCGCATTCCGTTCTTTATGGGACGTGCTCAGCCCAAAGCGGCATCGCCGCCCAACCTCG
TTCCCCAGCCGTTCGACAGTGTTGCGTCTATTGTCCAACGCTTCGGAGAGGTCGGATTCACAACGCCCGAGGAGATCGTTGCTGTAGTCGGTGGGTCGCACAGTGTTGCTGGAGCTGACG
ATGTCGTACCGGGTCTGCAAGG
GTAAGCATTGTGTCTACCTACTACTGACATAAGATTATTGACCACCTTCATCCCAATCAGCCTTCCGTTCGACCAAACGCCCTCTGTATTTGACAGTA
AGACTTTGCCGCCGATATGTGGCTTTAATTAAATGAGCTCACATATTTCTTAGCCCAAATATTCGTCGACGTGCAGCTGCGCGGCACTATTTTCACCGGGTACGTAGCTGCGTCATCTCA
CCAAAAATATGGTACTAAAGAATATATGTTTACAGACAAGGAGGCAACCAAGGAGAGACCGAAACCTCAGTTTTAGGCACAGTGCGCCTGCAGTCAGACCATCTCGTAAGTTAATAGTGT
TCTTCAGTATGTCAAGTGCGATTTTGACTCTCCCGGAAAAGCTCGCCCGTGACTCGCAGACAAACTGCGCCTGGCAGTCTTTCGCCAGTAAGTGGCATTTGTACCATCTCATCATTATGT
CCGATGATCTCATGTAAATTTTATTCTAGACAACCAGGCTGCTATGGCCGAAGCCTTCGGCCAGGGTGTCCTTAAGCTCTCGCTCTTGGGTCAGAACCAGGACGAGGTAGGGAAACCTGT
CAACATATCATTGAACAAAATTGATTATATGAATCTTCGATTAGCTGACTGACTGCAGCGAAGTTATTCCCGCGGCCATCCCGTTCACCGGTGGCCCAGCGACCCTCCCTCCTGGTTTGA
CAATGAACGACATTGAGCAGGCT
GTGAGTCTCTCTACAATGCAATGCATGAGGCACAGCTAAAGTGTTGACTAGTGCGCTACTGCTGCGTTCCCGTCGCTCGCCACTCAACCAGGTCCCG
CGACCTCCGTTCCTGCCAT
GTGCGACAATTTCGTTGTACTTCACATCTCTGCTTGCTGACATGTTGTGCTTCCCAGCCCCCAGGCCGACGACGACGACGACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCAGCGCTGCTCTATCCGCTCTCGCTCTCTCTCTTCCTCTTCTGTCTGTCAATGCACTCAGGACGAGGCGGGCTTTGTGCCCGGATGGTGTCAACACTGCCATTAACCTAGCG
TGTTGCTCTCTGTTCCCGGTGGTCCAAGACATACAGGAGAATTTTCTTACAAATGAATGCGGCGACAGT
GCTCACGGTGCTCTTCGCCTCGTCTTCCACGATGCTATTGGTATTTCTCCT
ACGGCAGG
GGGTGGAGGAGCTGACGGCTCTATTGCAACCTTCAATGAAACTGAGCTAACCTTCCCTGCCAACCTTGGTATCGATGACATCCTCGACGAGATTGGCCCATTCCTCCTAAAG
CACTCTAACACAATGAGCCCCGGTGACTT
CATTCAGCTCGCCGGTGCACTCAGTCTCGTGCAATGCCCGGGTGCCCCTCGCATTCCGTTCTTTATGGGACGTGCTCAGCCCAAAGCGGCA
TCGCCGCCCAACCTCGTTCCCCAGCCGTTCGACAGTGTTGCGTCTATTGTCCAACGCTTCGGAGAGGTCGGATTCACAACGCCCGAGGAGATCGTTGCTGTAGTCGGTGGGTCGCACAGT
GTTGCTGGAGCTGACGATGTCGTACCGGGTCTGCAAGG
CCTTCCGTTCGACCAAACGCCCTCTGTATTTGACACCCAAATATTCGTCGACGTGCAGCTGCGCGGCACTATTTTCACCGGA
CAAGGAGGCAACCAAGGAGAGACCGAAACCTCAGTTTTAGGCACAGTGCGCCTGCAGTCAGACCATCTC
CTCGCCCGTGACTCGCAGACAAACTGCGCCTGGCAGTCTTTCGCCAACAAC
CAGGCTGCTATGGCCGAAGCCTTCGGCCAGGGTGTCCTTAAGCTCTCGCTCTTGGGTCAGAACCAGGACGAG
CTGACTGACTGCAGCGAAGTTATTCCCGCGGCCATCCCGTTCACCGGT
GGCCCAGCGACCCTCCCTCCTGGTTTGACAATGAACGACATTGAGCAGGCT
TGCGCTACTGCTGCGTTCCCGTCGCTCGCCACTCAACCAGGTCCCGCGACCTCCGTTCCTGCCATCCCC
CAGGCCGACGACGACGACGACTCTTAA

Retrieve as FASTA