Entry information : HsubCIIBC04
Entry ID 10562
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-05-24 (Nizar Fawal)
Peroxidase information: HsubCIIBC04
Name HsubCIIBC04
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBC04
start..stop
S start..stop
GmarCIIBC06 596 0 1..354 1..354
HsubCIIBC02 589 0 1..357 1..357
GmarCIIBC14 583 0 1..357 1..357
GmarCIIBC12 578 0 1..354 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94073..94199 127 N° 2 94260..94324 65 N° 3 94379..94433 55 N° 4 94494..94569 76
N° 5 94627..94692 66 N° 6 94752..95024 273 N° 7 95081..95247 167 N° 8 95300..95466 167
N° 9 95526..95603 78  
join(94073..94199,94260..94324,94379..94433,94494..94569,94627..94692,94752..950 24,95081..95247,95300..95466,95526..95603)


exon

Literature and cross-references HsubCIIBC04
DNA ref. JGI genome:   scaffold_24 (94073..95603)
Cluster/Prediction ref. JGI gene:   184750
Protein sequence: HsubCIIBC04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (335)
PWM (Da):   %s   36986.56 (34687.3)  
PI (pH):   %s   4.77 (4.66) Peptide Signal:   %s   cut: 23 range:23-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFARLSAIVSIALAASQLAQAGLTKRVTCASGQTTANAACCALFPIVDFIQTNLFDGGECGEEAHSALRLAFHDAIGFSIHGGKGGGADGSILAFNQTETAFHANGGIDDITDRQFDVWQNTTLTAGDFVHLAAAIGTGNCPGAPRLQFAFGRPPPKAPAPDLTVPEPTDSVTAILARFADAGFSTPEVVALLASHTIAAADVVDPTIPGTPFDSTVGTFDTQVFLEVLLKGTLFPGNGSQSGEVLSPIHGEMRLQSDFAISQDARTACLWQGFINNQNLMMSQFKAAMAKLQVLGQKNLIDCSDVVPVPATFPGPIKFPASFSQKDVQVACHQSAFPSLATVAGPAPTLAPVPGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCGCTCGTCTATCTGCCATTGTTTCGATCGCTCTTGCAGCGTCGCAGCTTGCTCAGGCCGGTCTCACCAAGCGCGTCACCTGTGCTTCCGGTCAGACCACCGCGAACGCGGCA
TGCTGCG
GTATGCGTGCTTTCTATTTATATCAATTGACACGTTGATCCTGATACAATCCTACTATAGCTCTGTTCCCCATTGTAGACTTTATCCAAACCAACCTCTTCGATGGCGGTGAG
TGCGGGGAGGAG
GTGAGTACGCGTATATAGATTGAACGTAACCTCTAACCTTTATCGCCTCATCAGGCCCACTCTGCGTTGCGTCTGGCTTTCCATGATGCCATCGGTTTCTCTATCCAT
G
GTGAGATCGAGGTCATGTTCTCCAGTCGTCGTTACGGTCACTGACGCGTTTAACTGTTAGGTGGAAAGGGAGGAGGAGCTGACGGATCCATTCTCGCTTTCAATCAGACAGAAACGGCA
TTCCACGCAAATGGGGG
GTGAGTTCCATGCTAAAATGCTTGTAACCTTGCAAATATCTGATATTGTATGGATAGCATCGACGATATCACCGATCGTCAATTTGATGTCTGGCAGAACACT
ACCTTGACGGCTGGTGACTT
GTAAGTGCAATTCTAATAGCCCGCCTACTAAGCACTGATCGTCATTCATTCACTGTCAGCGTACATCTGGCTGCTGCGATCGGTACAGGCAATTGTCCTG
GAGCTCCTCGCCTCCAATTTGCGTTTGGTCGCCCACCCCCGAAGGCACCTGCCCCTGACCTGACGGTCCCCGAGCCCACTGACAGCGTGACCGCAATCCTTGCCCGTTTTGCTGACGCCG
GCTTCTCTACTCCTGAAGTTGTCGCTCTTCTCGCTTCCCACACCATCGCTGCAGCCGACGTGGTCGACCCGACCATTCCGGGAACGCCTTTCGATTCTACCGTTGGAACTTT
GTGCGTAC
TTTATATTTCATTCTCAGCGATTCGGCCGTCATTGACAATATTTATAGTGATACTCAAGTCTTCCTTGAAGTTTTGCTCAAGGGGACTCTATTCCCAGGAAACGGATCGCAGTCCGGAGA
AGTTCTCTCACCCATTCATGGTGAAATGCGCCTGCAGAGCGACTTCGCCATTTCCCAAGATGCGAGAACCGCTTGTCTTTGGCAAGGATTTATCA
GTAAGTATAGTTTTCGCCCATTCAT
ATTCGCTCAACCACTCATACTTCACAGACAACCAGAATTTGATGATGTCGCAGTTCAAGGCGGCCATGGCCAAGCTTCAGGTCCTTGGACAGAAGAATCTGATTGACTGCTCAGATGTTG
TCCCCGTTCCCGCAACATTCCCTGGACCGATCAAATTCCCTGCCAGTTTCTCGCAAAAAGACGTCCAAGTTGCC
GTACGTGCTATTCCTTCGTCATGTTTGCCTCATATATTCTAATTAA
CCGGTATACGCAGTGCCACCAGAGTGCCTTCCCCAGCCTTGCGACCGTCGCAGGCCCCGCTCCTACTCTCGCTCCTGTACCAGGCTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCGCTCGTCTATCTGCCATTGTTTCGATCGCTCTTGCAGCGTCGCAGCTTGCTCAGGCCGGTCTCACCAAGCGCGTCACCTGTGCTTCCGGTCAGACCACCGCGAACGCGGCA
TGCTGCG
CTCTGTTCCCCATTGTAGACTTTATCCAAACCAACCTCTTCGATGGCGGTGAGTGCGGGGAGGAGGCCCACTCTGCGTTGCGTCTGGCTTTCCATGATGCCATCGGTTTCTCT
ATCCATG
GTGGAAAGGGAGGAGGAGCTGACGGATCCATTCTCGCTTTCAATCAGACAGAAACGGCATTCCACGCAAATGGGGGCATCGACGATATCACCGATCGTCAATTTGATGTCTGG
CAGAACACTACCTTGACGGCTGGTGACTT
CGTACATCTGGCTGCTGCGATCGGTACAGGCAATTGTCCTGGAGCTCCTCGCCTCCAATTTGCGTTTGGTCGCCCACCCCCGAAGGCACCT
GCCCCTGACCTGACGGTCCCCGAGCCCACTGACAGCGTGACCGCAATCCTTGCCCGTTTTGCTGACGCCGGCTTCTCTACTCCTGAAGTTGTCGCTCTTCTCGCTTCCCACACCATCGCT
GCAGCCGACGTGGTCGACCCGACCATTCCGGGAACGCCTTTCGATTCTACCGTTGGAACTTT
TGATACTCAAGTCTTCCTTGAAGTTTTGCTCAAGGGGACTCTATTCCCAGGAAACGGA
TCGCAGTCCGGAGAAGTTCTCTCACCCATTCATGGTGAAATGCGCCTGCAGAGCGACTTCGCCATTTCCCAAGATGCGAGAACCGCTTGTCTTTGGCAAGGATTTATCA
ACAACCAGAAT
TTGATGATGTCGCAGTTCAAGGCGGCCATGGCCAAGCTTCAGGTCCTTGGACAGAAGAATCTGATTGACTGCTCAGATGTTGTCCCCGTTCCCGCAACATTCCCTGGACCGATCAAATTC
CCTGCCAGTTTCTCGCAAAAAGACGTCCAAGTTGCC
TGCCACCAGAGTGCCTTCCCCAGCCTTGCGACCGTCGCAGGCCCCGCTCCTACTCTCGCTCCTGTACCAGGCTCGTAA

Retrieve as FASTA