Entry information : HsubCIIBB07
Entry ID 10563
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: HsubCIIBB07
Name HsubCIIBB07
Class Other class II peroxidase type B    [Orthogroup: CIIBB002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBB07
start..stop
S start..stop
HsubCIIBB04 582 0 16..364 15..364
HsubCIIBB06 571 0 20..365 19..365
HsubCIIBB01 548 0 1..364 1..364
HsubCIIBB08 545 0 1..362 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27091..27154 64 N° 2 27215..27342 128 N° 3 27396..27454 59 N° 4 27507..27647 141
N° 5 27706..27951 246 N° 6 28008..28042 35 N° 7 28093..28138 46 N° 8 28191..28260 70
N° 9 28315..28360 46 N° 10 28423..28499 77 N° 11 28557..28655 99 N° 12 28712..28776 65
N° 13 28828..28852 25  
join(27091..27154,27215..27342,27396..27454,27507..27647,27706..27951,28008..280 42,28093..28138,28191..28260,28315..28360,28423..28499,28557..28655,28712..28776 ,28828..28852)


exon

Literature and cross-references HsubCIIBB07
DNA ref. JGI genome:   scaffold_107 (27091..28852)
Cluster/Prediction ref. JGI gene:   47473
Protein sequence: HsubCIIBB07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (344)
PWM (Da):   %s   37719.92 (35360.6)  
PI (pH):   %s   3.89 (3.91) Peptide Signal:   %s   cut: 23 range:23-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFSPTLTSLVLALFPLASVNALRTKRTLCPDGVNTAVNPACCALFPVVQDLADNLFENECGDAHGALRLVFHDAIGISPTLGGGGADGSIVIFNQTELENPANLGIDDILSTLSPFLFKHLDTLSAGDFVQLAGAVSLVQCPGAPRIPFFSGRAPPVAAAPTGLVPQPFDSVASILQRFGEVGFSPEEVVAVVGGSHSVAGADDIVPNMQGIPFDQTPSVFTQIFVDVQLRGTLFTGEGGQQGEVETAVAGTVRLQSDSLARDSSTSCAWQSFANNQSGIETAFGQAVLKLSLLGQVQSLTDCSEVIPAAIAFTGGPATLPPGLTMNDIEQACPTAPFPTLSTQPGPATSVPPIPQADDDS

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAGTCCTACTCTAACTTCCCTTGTGCTCGCACTGTTCCCCTTGGCGTCGGTCAATGGTGGGTTTAGTGCTATATTCTCGCTGTAAGCAGTCCCAGAAATGCTTACCGTTTCT
TTAGCTCTGCGAACCAAGCGCACGCTGTGCCCAGATGGTGTCAACACTGCAGTTAACCCAGCGTGCTGCGCCCTATTCCCTGTCGTTCAAGACCTGGCAGATAACCTTTTTGAGAACGAA
TGCGGCGATTCT
GTCAGTCGCGCATAGTTTTCGGTTTTTGTTAATTGACTCTAATGCTCACGTAGGCTCACGGTGCTCTTCGTCTTGTGTTTCACGACGCCATTGGAATTTCGCCCACTT
TGGG
GTATGTATCATTAATCTTCGTCCATTTTATATTCTGATACAGAGCTATTCAGCGGTGGAGGTGCTGATGGCTCCATTGTCATTTTCAATCAGACAGAACTGGAAAATCCCGCTAAC
CTGGGCATTGACGATATCCTGAGCACCCTTAGCCCATTCCTCTTCAAACACCTCGACACATTGTCAGCCGGCGACTT
GTAAGCAGCATTTGTCAAATATTTGAGAGAATATTGTTCTAAC
ATTTGATTTTTCAAGTGTTCAACTCGCTGGTGCAGTCAGTCTCGTTCAATGCCCCGGTGCTCCTCGTATTCCTTTCTTCAGTGGCCGTGCTCCCCCTGTGGCTGCAGCACCTACTGGCCT
TGTACCTCAGCCTTTTGACAGCGTTGCGTCGATTCTTCAACGTTTCGGAGAGGTTGGCTTTTCGCCTGAAGAAGTTGTCGCCGTTGTGGGTGGCTCCCACAGCGTCGCCGGAGCCGACGA
CATTGTACCGAACATGCAAGG
GTAGCTGGTTTTCTTCGATCTCATGCTCTAGAAAATTACTCACCAAGATTTTGTAGAATTCCGTTTGACCAGACCCCATCCGTGTTCGACAGTAAGTCC
TGATCCATGCGTCCATGGTAACTGCATTAATGCATTACATAGCTCAAATTTTTGTTGATGTACAACTTCGTGGTACTTTGTTTACTGGGTATGCATACTAGCCTTCCGAGCACAAGATTT
AAGCTAACATCTAAAAATAGGGAGGGAGGCCAACAGGGAGAAGTCGAGACTGCAGTGGCCGGCACGGTACGCTTACAGTCAGACAGCCTCGTACGTCATTTTTGCGTGCTATCTACTACA
TTATACTGAAGTGAAAAAATCAAGCTTGCTCGTGATTCATCTACTAGCTGTGCATGGCAATCTTTTGCTAGTAAGTGCCAGCCTATTTGATTATGGTATATCTGATTTAATCTTGCTTGA
AATAAAATCAAGACAATCAATCGGGAATTGAAACGGCCTTCGGTCAGGCTGTCCTCAAGCTCTCTTTGCTGGGCCAGGTCCAGAGTCAGGTAGGGGTTGTTGTTCATTGTCGCAAGGAAT
GAATTATAATAATCTTGGCTGTTTAGTTGACTGACTGCAGCGAAGTGATCCCTGCAGCTATCGCGTTCACTGGTGGTCCAGCGACACTCCCGCCTGGTTTGACAATGAACGACATTGAGC
AAGCG
GTAAGTCTAAAAATATTCATATCTATATCTAATACTCATCTGTTGTCCTTAATTAGTGCCCCACTGCTCCGTTCCCGACGCTTTCCACTCAACCAGGCCCGGCGACCTCAGTTCC
TCCCAT
GTTCGTCACGTCGATCTTTTCTCTTGATTATCAATTCTAACTTCCATCCAGTCCCCAGGCCGATGACGACTCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAGTCCTACTCTAACTTCCCTTGTGCTCGCACTGTTCCCCTTGGCGTCGGTCAATGCTCTGCGAACCAAGCGCACGCTGTGCCCAGATGGTGTCAACACTGCAGTTAACCCA
GCGTGCTGCGCCCTATTCCCTGTCGTTCAAGACCTGGCAGATAACCTTTTTGAGAACGAATGCGGCGATTCT
GCTCACGGTGCTCTTCGTCTTGTGTTTCACGACGCCATTGGAATTTCG
CCCACTTTGGG
CGGTGGAGGTGCTGATGGCTCCATTGTCATTTTCAATCAGACAGAACTGGAAAATCCCGCTAACCTGGGCATTGACGATATCCTGAGCACCCTTAGCCCATTCCTCTTC
AAACACCTCGACACATTGTCAGCCGGCGACTT
TGTTCAACTCGCTGGTGCAGTCAGTCTCGTTCAATGCCCCGGTGCTCCTCGTATTCCTTTCTTCAGTGGCCGTGCTCCCCCTGTGGCT
GCAGCACCTACTGGCCTTGTACCTCAGCCTTTTGACAGCGTTGCGTCGATTCTTCAACGTTTCGGAGAGGTTGGCTTTTCGCCTGAAGAAGTTGTCGCCGTTGTGGGTGGCTCCCACAGC
GTCGCCGGAGCCGACGACATTGTACCGAACATGCAAGG
AATTCCGTTTGACCAGACCCCATCCGTGTTCGACACTCAAATTTTTGTTGATGTACAACTTCGTGGTACTTTGTTTACTGGG
GAGGGAGGCCAACAGGGAGAAGTCGAGACTGCAGTGGCCGGCACGGTACGCTTACAGTCAGACAGCCTC
CTTGCTCGTGATTCATCTACTAGCTGTGCATGGCAATCTTTTGCTAACAAT
CAATCGGGAATTGAAACGGCCTTCGGTCAGGCTGTCCTCAAGCTCTCTTTGCTGGGCCAGGTCCAGAGTCAG
TTGACTGACTGCAGCGAAGTGATCCCTGCAGCTATCGCGTTCACTGGT
GGTCCAGCGACACTCCCGCCTGGTTTGACAATGAACGACATTGAGCAAGCG
TGCCCCACTGCTCCGTTCCCGACGCTTTCCACTCAACCAGGCCCGGCGACCTCAGTTCCTCCCATTCCC
CAGGCCGATGACGACTCATAG

Retrieve as FASTA