Entry information : HsubCIIBB08
Entry ID 10567
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: HsubCIIBB08
Name HsubCIIBB08
Class Other class II peroxidase type B    [Orthogroup: CIIBB002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBB08
start..stop
S start..stop
HsubCIIBB04 617 0 1..361 1..362
HsubCIIBB06 576 0 19..361 19..362
HsubCIIBB01 573 0 1..361 1..362
HsubCIIBB07 561 0 1..361 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35847..35907 61 N° 2 35651..35778 128 N° 3 35525..35583 59 N° 4 35327..35467 141
N° 5 35032..35277 246 N° 6 34945..34979 35 N° 7 34842..34887 46 N° 8 34719..34788 70
N° 9 34619..34664 46 N° 10 34481..34557 77 N° 11 34323..34421 99 N° 12 34232..34271 40
N° 13 34154..34178 25 N° 14 34085..34100 16  
complement(join(34085..34100,34154..34178,34232..34271,34323..34421,34481..34557 ,34619..34664,34719..34788,34842..34887,34945..34979,35032..35277,35327..35467,3 5525..35583,35651..35778,35847..35907))


exon

Literature and cross-references HsubCIIBB08
DNA ref. JGI genome:   scaffold_113 (35907..34085)
Cluster/Prediction ref. JGI gene:   207400
Protein sequence: HsubCIIBB08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (341)
PWM (Da):   %s   37497.93 (35317.7)  
PI (pH):   %s   4.4 (4.40) Peptide Signal:   %s   cut: 22 range:22-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFGSVLSILGLVLPLLSVNGLRTKRSLCPDGVNTAINQACCALFPIVDDLKENLFDNECGDAHGALRLVFHDAIGISPSLGGGGADGSIATFNETELTFHANTGIDDVLDAVGPFLQKHSNVLTPGDFIQLAGAISLVQCPGAPRIPFFMGRTHPVAASPPGLVPEPFDSVQTILKRFGEVGFTSDEVVAVVGGSHSIAGADDIVPNEQGVPFDQTPSLFTQIFVDVQLRGTMFTGQGGQQGEVQSAVAGLVRLQSDHLARDSATNCAWQSFVNNQPKLAAAFGSGVLKLSLLGQNQAMTDCSEVIPKAIPFTGGPATLPPGQTMNDIEQACATAAFPSLATQPGPATAVPQIPQAV

Retrieve as FASTA  
Remarks Complete sequence from genomic (13 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGGCAGTGTCCTCTCAATCCTCGGGCTCGTTCTCCCGCTTCTGTCCGTTAATGGTGCGTTAACGTTCAGCGTTCGATATTCAACATGAGCTACAGCTATAGATATCGATTTA
ATATCTCAGGGCTAAGAACCAAGCGCTCTTTGTGCCCCGATGGTGTTAACACTGCCATAAACCAGGCGTGTTGCGCTTTGTTTCCTATTGTCGATGACCTGAAGGAAAATTTGTTCGACA
ACGAATGCGGTGACGCC
GTATGTTGCTCTTATATCTATATCTATTTAATAGGAAACATAGAATGTCGTCTGACATTTTCTACAGGCTCATGGGGCGCTTCGTCTCGTATTCCACGACGCC
ATCGGTATTTCACCCTCATTAGG
GTACGTCAATCCGCCAACCCAGATGCCATTTACGAGCACTAATTTATTTGTAAACAGTGGTGGTGGTGCCGATGGATCTATTGCAACTTTTAATGAG
ACGGAACTAACCTTCCACGCCAATACCGGGATTGACGACGTTCTCGATGCTGTCGGCCCGTTTCTCCAAAAGCATTCCAACGTTCTGACTCCTGGAGACTT
GTAAGTCCACTGAGATACT
GTAAGTATACCCTTAATGAATATGTCTTAGCATCCAACTCGCAGGCGCTATCAGCCTTGTACAGTGCCCAGGTGCTCCACGCATCCCATTCTTCATGGGACGCACGCACCCCGTGGCCGC
ATCACCTCCCGGTCTTGTCCCCGAGCCATTTGACAGCGTTCAGACCATTTTAAAGCGTTTCGGCGAGGTAGGATTTACCTCTGATGAAGTTGTCGCCGTGGTCGGTGGATCGCACAGCAT
TGCCGGAGCCGACGACATTGTGCCTAATGAGCAAGG
GTGAGCTTACAGACCGTAGTCGATTTCACCTCAGGGTTCAAATTTCGTACAGTGTTCCTTTCGACCAAACACCTTCGTTGTTCG
ACA
GTAGGCCAATTTATCGTGTGCTAACTATTTTTTTTGTGAGTCTAACTACGTCTTTAGCTCAAATCTTTGTCGATGTCCAACTTCGTGGAACCATGTTCACTGGGTATGAATTAATGT
CGAGAAAAAAGAAATTATCTCATTTAGAGGTGATAATAGGCAAGGAGGTCAGCAAGGAGAGGTCCAGTCGGCTGTTGCTGGCTTAGTTCGTCTGCAATCCGACCATCTTGTAAGTCATTA
CAAGTTTCCTACACCAATCCTTACTCAGAATTTGTATACATAGCTGGCTCGCGATTCTGCAACCAACTGTGCCTGGCAGTCATTCGTCAGTCAGTCAACGTTTGTTATGCAGCATTTCCT
TCTGAATAATCTAACGTAAATTAAACATAGACAACCAACCGAAATTGGCGGCAGCATTCGGATCCGGTGTTCTTAAACTTTCTCTCCTCGGTCAGAACCAAGCCAAGGTAAAATATATAG
CGCGTGAAAAATATCTTTGAACAGATGTTAATATCACCTCTTACAGATGACAGACTGCAGCGAAGTCATCCCTAAAGCTATTCCGTTCACTGGTGGCCCAGCAACCCTCCCTCCTGGCCA
GACCATGAACGATATTGAGCAGGCG
GTGAGTCTAATTTTCGAAAGTCGTGTTGGGCGCCATCTTGAATGTGATTAGTGTGCTACTGCTGCGTTCCCTTCTCTCGCCACTCAGCCAGGTGT
GTACTAATTGCCTTCAAATTACGCTGATTTTACTGATATGATATTCCAGGTCCAGCGACTGCTGTTCCCCAAATGTATGTCTATCGTAATCATCGTCAGGCTGTTCTCACTAACGTTGTA
TCTGAAGTCCCCAGGCTGTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGGCAGTGTCCTCTCAATCCTCGGGCTCGTTCTCCCGCTTCTGTCCGTTAATGGGCTAAGAACCAAGCGCTCTTTGTGCCCCGATGGTGTTAACACTGCCATAAACCAGGCG
TGTTGCGCTTTGTTTCCTATTGTCGATGACCTGAAGGAAAATTTGTTCGACAACGAATGCGGTGACGCC
GCTCATGGGGCGCTTCGTCTCGTATTCCACGACGCCATCGGTATTTCACCC
TCATTAGG
TGGTGGTGGTGCCGATGGATCTATTGCAACTTTTAATGAGACGGAACTAACCTTCCACGCCAATACCGGGATTGACGACGTTCTCGATGCTGTCGGCCCGTTTCTCCAAAAG
CATTCCAACGTTCTGACTCCTGGAGACTT
CATCCAACTCGCAGGCGCTATCAGCCTTGTACAGTGCCCAGGTGCTCCACGCATCCCATTCTTCATGGGACGCACGCACCCCGTGGCCGCA
TCACCTCCCGGTCTTGTCCCCGAGCCATTTGACAGCGTTCAGACCATTTTAAAGCGTTTCGGCGAGGTAGGATTTACCTCTGATGAAGTTGTCGCCGTGGTCGGTGGATCGCACAGCATT
GCCGGAGCCGACGACATTGTGCCTAATGAGCAAGG
TGTTCCTTTCGACCAAACACCTTCGTTGTTCGACACTCAAATCTTTGTCGATGTCCAACTTCGTGGAACCATGTTCACTGGGCAA
GGAGGTCAGCAAGGAGAGGTCCAGTCGGCTGTTGCTGGCTTAGTTCGTCTGCAATCCGACCATCTT
CTGGCTCGCGATTCTGCAACCAACTGTGCCTGGCAGTCATTCGTCAACAACCAA
CCGAAATTGGCGGCAGCATTCGGATCCGGTGTTCTTAAACTTTCTCTCCTCGGTCAGAACCAAGCCAAG
ATGACAGACTGCAGCGAAGTCATCCCTAAAGCTATTCCGTTCACTGGTGGC
CCAGCAACCCTCCCTCCTGGCCAGACCATGAACGATATTGAGCAGGCG
TGTGCTACTGCTGCGTTCCCTTCTCTCGCCACTCAGCCAGGTCCAGCGACTGCTGTTCCCCAAATTCCCCAG
GCTGTCTAA

Retrieve as FASTA