Entry information : HsubCIIBB05
Entry ID 10568
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: HsubCIIBB05
Name HsubCIIBB05
Class Other class II peroxidase type B    [Orthogroup: CIIBB002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCIIBB05
start..stop
S start..stop
HsubCIIBB09 634 0 1..366 1..366
HsubCIIBB03 624 0 1..366 1..366
HsubCIIBB02 623 0 1..366 1..366
HsubCIIBB10 621 0 1..366 1..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 112890..112950 61 N° 2 112652..112838 187 N° 3 112455..112595 141 N° 4 112156..112401 246
N° 5 112066..112100 35 N° 6 111965..112013 49 N° 7 111841..111910 70 N° 8 111740..111785 46
N° 9 111608..111684 77 N° 10 111454..111552 99 N° 11 111330..111394 65 N° 12 111233..111275 43
complement(join(111233..111275,111330..111394,111454..111552,111608..111684,1117 40..111785,111841..111910,111965..112013,112066..112100,112156..112401,112455..1 12595,112652..112838,112890..112950))


exon

Literature and cross-references HsubCIIBB05
DNA ref. JGI genome:   scaffold_107 (112950..111233)
Cluster/Prediction ref. JGI gene:   207174
Protein sequence: HsubCIIBB05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373 (351)
PWM (Da):   %s   38346.24 (36047.9)  
PI (pH):   %s   4.24 (4.27) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFNIALSAFVLALPLLLVDAASTKRSMCSDGRSAAANSACCAVFPVVEDIVDNLFTNECGDSAHGALRLLFHDAIGISPTAGGGGADGSIATFNATELTFPANLGIDDILDDLGPFLLKHSNVLSAGDFIQLAGAVSLVQCPGAPRIPFFMGRPAPVAASPPNLVPQPTDDITTILDRFGSVGFSPAEVVAVVGGSHSVAGADDVVPNFEGVPFDQTPAQFTQIFVDVLLRGTAFTDGQGAQSGESETAVAGTVRLQSDGLARDPRTACTWQSFVNQQSKMAQAFGEAVLKLSFLGQNQHLTDCSEVIPQAIALKTGAATFPPGKTVKDIELSCNDAKFPNLRTQPGPATTVSPIPQAVSTSTAAPAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCAACATCGCCCTTTCCGCATTTGTGCTTGCGCTGCCCCTTCTCTTGGTCGACGGTGAGCACGGTCTCTAACTTCGAAATTACACGTGTTCAACAGCGTCTTTAGCCGCCAGT
ACCAAACGCTCTATGTGCTCCGATGGACGCAGCGCTGCAGCCAATTCGGCGTGCTGCGCCGTGTTTCCCGTCGTCGAAGACATAGTCGACAACCTTTTCACTAACGAATGCGGTGACTCG
GCCCACGGAGCCCTTCGTCTCCTTTTCCATGATGCCATTGGAATTTCGCCAACGGCAGG
GTGTGTCTGTTTAGATATTTTCCATATTAAAATGAGCTCTAATAAATATTATACAGCGGTG
GAGGAGCCGACGGCTCTATTGCCACATTCAACGCCACGGAGCTGACTTTCCCCGCCAACCTGGGCATCGACGACATCCTGGACGACCTTGGCCCATTCCTCCTCAAGCACTCCAATGTCC
TCTCCGCCGGAGACTT
GTAAGTAAATCGGCCGGTACACATGAGGTGTCGCTAACATTATCCATTTGCAGCATTCAGCTCGCTGGTGCGGTTAGTCTGGTGCAATGCCCCGGTGCCCCTCG
TATTCCGTTCTTCATGGGACGTCCTGCACCCGTGGCGGCATCGCCCCCCAACCTTGTTCCTCAGCCCACTGACGATATCACCACCATTCTTGATCGCTTCGGCTCCGTCGGGTTTTCACC
TGCCGAAGTCGTCGCCGTCGTTGGCGGGTCGCACAGTGTTGCTGGTGCTGACGACGTTGTGCCCAACTTCGAGGG
GTACGATTTATTACCATGATATGGATAATTTTGTAAATTACTAAC
CTCCTTGAAGAGTGCCTTTCGATCAGACTCCAGCTCAATTTGATAGTACGAACCTACTCATGCGAGTTTTATGTTGAAATACTGACATATATTTCAGCTCAGATATTCGTTGATGTGCTC
CTCCGCGGCACCGCATTCACCGACGG
GTATGCACAAGCGATGCTATTCTTTTTTGTTTCTCATTAATTCATTGCATGCAGTCAAGGAGCCCAGTCCGGTGAATCAGAGACCGCTGTCGCT
GGGACGGTGCGCCTCCAGTCAGACGGACTT
GTAAAGTTTTTTCCACTACTACTTAGCACCGAGTATACTTATCGTCTTTCAATAGCTTGCTCGTGACCCAAGAACCGCTTGCACCTGGCA
ATCATTCGTCA
GTAAGTAAAGAGTTTGACTTGATCAAGGAGTGGTATTTACCTCATCGCACGACAGACCAGCAATCAAAGATGGCTCAGGCCTTTGGAGAAGCCGTGCTCAAGCTTTCTT
TCTTGGGTCAAAACCAGCACGAG
GTATCTAATAGACTTATCTGAAATTCACACTAAGCTAATAGTTCGTGTCTACTAGCTAACCGACTGTAGCGAGGTTATCCCTCAGGCTATTGCGCTC
AAGACCGGCGCGGCGACCTTCCCACCTGGCAAGACCGTCAAAGATATTGAGCTCTCT
GTGAGTTCATTATTACGTCTTTATTATATATAACAAAATTGTAGCTCACATGCGATTAGTGCA
ACGATGCGAAGTTCCCTAACCTCCGCACTCAGCCTGGCCCAGCGACCACCGTCTCTCCTAT
GTGCGTTGATTCTGATTTCTTGTCATAAATCTATTTGTGACATATTCCTTCCAGTCCCC
AAGCTGTCAGCACCAGCACAGCCGCCCCCGCTTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCAACATCGCCCTTTCCGCATTTGTGCTTGCGCTGCCCCTTCTCTTGGTCGACGCCGCCAGTACCAAACGCTCTATGTGCTCCGATGGACGCAGCGCTGCAGCCAATTCGGCG
TGCTGCGCCGTGTTTCCCGTCGTCGAAGACATAGTCGACAACCTTTTCACTAACGAATGCGGTGACTCGGCCCACGGAGCCCTTCGTCTCCTTTTCCATGATGCCATTGGAATTTCGCCA
ACGGCAGG
CGGTGGAGGAGCCGACGGCTCTATTGCCACATTCAACGCCACGGAGCTGACTTTCCCCGCCAACCTGGGCATCGACGACATCCTGGACGACCTTGGCCCATTCCTCCTCAAG
CACTCCAATGTCCTCTCCGCCGGAGACTT
CATTCAGCTCGCTGGTGCGGTTAGTCTGGTGCAATGCCCCGGTGCCCCTCGTATTCCGTTCTTCATGGGACGTCCTGCACCCGTGGCGGCA
TCGCCCCCCAACCTTGTTCCTCAGCCCACTGACGATATCACCACCATTCTTGATCGCTTCGGCTCCGTCGGGTTTTCACCTGCCGAAGTCGTCGCCGTCGTTGGCGGGTCGCACAGTGTT
GCTGGTGCTGACGACGTTGTGCCCAACTTCGAGGG
AGTGCCTTTCGATCAGACTCCAGCTCAATTTGATACTCAGATATTCGTTGATGTGCTCCTCCGCGGCACCGCATTCACCGACGGT
CAAGGAGCCCAGTCCGGTGAATCAGAGACCGCTGTCGCTGGGACGGTGCGCCTCCAGTCAGACGGACTT
CTTGCTCGTGACCCAAGAACCGCTTGCACCTGGCAATCATTCGTCAACCAG
CAATCAAAGATGGCTCAGGCCTTTGGAGAAGCCGTGCTCAAGCTTTCTTTCTTGGGTCAAAACCAGCACGAG
CTAACCGACTGTAGCGAGGTTATCCCTCAGGCTATTGCGCTCAAGACC
GGCGCGGCGACCTTCCCACCTGGCAAGACCGTCAAAGATATTGAGCTCTCT
TGCAACGATGCGAAGTTCCCTAACCTCCGCACTCAGCCTGGCCCAGCGACCACCGTCTCTCCTATTCCC
CAAGCTGTCAGCACCAGCACAGCCGCCCCCGCTTCTTGA

Retrieve as FASTA