Entry information : HsubCcP
Entry ID 10569
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HsubCcP
Name HsubCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubCcP
start..stop
S start..stop
GmarCcP 615 0 1..377 1..381
HcyCcP 572 0 1..370 1..376
SlacCcP01 566 0 1..374 1..371
PoCcP_PC9 561 0 10..377 6..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 109756..110058 303 N° 2 110115..110163 49 N° 3 110216..110297 82 N° 4 110357..110510 154
N° 5 110572..111005 434 N° 6 111068..111185 118  
join(109756..110058,110115..110163,110216..110297,110357..110510,110572..111005, 111068..111185)


exon

Literature and cross-references HsubCcP
DNA ref. JGI genome:   scaffold_85 (109756..111185)
Cluster/Prediction ref. JGI gene:   46322
Protein sequence: HsubCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380
PWM (Da):   %s   42176.21  
PI (pH):   %s   8.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFNAFRNPLRASVRRAAAQPARFQLRVNCNRKFSTPPPPPAPEAKASSNAGLYIGLGAVVAGGLGYYLYSSNDAVNALKSGAQVAKVKTNTAPTKEDYIKVYNRIAELIDDAGEYDDGSYGPVILRLAWHSSGTYDKDSKTGGSNYATMRFNPESKHGANAGLNIARDLMEKVKEEFPWISYGDLWTLGGVAAIEMAGPKVPWRPGRVDGVEAQATPDGRLPDATQGADHLRNIFGRMGFNDQEIVALSGAHALGRCHRDRSGFEGPWSFAPTTVTNDYFRLLFDEKWVWKRWEGPKQLEDKKTRSLMMLPTDYVLVQDKSFKKFAKQYADSQDLWFKDFSKAVATLFELGVPTEQFVTPEPWTIPTVDEQKEEKKD

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCAACGCCTTCCGAAACCCTCTCCGTGCTAGCGTGCGCAGGGCCGCCGCCCAGCCGGCGAGGTTCCAGCTTCGCGTCAACTGCAACCGCAAGTTCTCGACCCCACCACCTCCG
CCTGCGCCCGAAGCAAAGGCGTCCTCCAACGCTGGTCTATACATTGGCCTCGGAGCAGTCGTTGCTGGAGGTCTGGGATACTACCTATACAGCAGTAACGACGCTGTCAACGCGCTCAAG
TCTGGCGCGCAGGTTGCCAAGGTCAAGACCAACACCGCTCCCACCAAGGAAGACTACATCAAG
GTTTGTTATTTTTCTACATTCTTCTATAGGATCCTGGCTTATTCACATGTCCGCAGG
TCTACAACAGGATCGCTGAGCTCATTGACGATGCCGGCGAATATGACG
GTGACATCCACTTGACACGTCCTAACTTATCGGCGCTAATAGAAATTTCTAGATGGTTCTTACGGGCCCGTT
ATCCTCCGGCTCGCCTGGCATTCGTCGGGAACATACGACAAGGACTCTAAGACCGGTGGAAG
GTCAGTGATTTTGGGTGTCTCGTCATTGCTCAGTCCCTGATACCATCCGCCGCTGCTA
GCAACTATGCTACAATGCGCTTCAATCCCGAATCTAAGCACGGTGCCAACGCAGGGCTGAACATTGCTCGCGATCTCATGGAGAAGGTCAAAGAGGAATTCCCCTGGATCAGCTACGGTG
ATCTCTGGACTCTCGGTGGTGTCGCTGCTATTCAG
GTATGCCCCTGCCTTTAGAACATGGACGATCAAGTATATGTAATGTCACTCGGATTCATAGGAAATGGCTGGCCCCAAGGTCCCA
TGGCGCCCTGGCCGTGTTGACGGTGTCGAGGCTCAGGCCACCCCTGACGGTCGCCTTCCCGACGCTACCCAAGGTGCTGACCACCTGAGGAACATCTTCGGCCGCATGGGATTCAACGAC
CAGGAGATCGTCGCCCTTTCAGGTGCGCACGCCCTCGGCCGCTGCCATCGCGACCGCTCTGGATTCGAAGGCCCCTGGTCATTCGCGCCCACCACCGTGACCAACGACTACTTCCGCCTC
CTCTTCGACGAGAAATGGGTCTGGAAGCGCTGGGAGGGCCCGAAGCAGCTCGAGGACAAGAAGACGCGCAGCCTGATGATGCTGCCCACCGATTACGTCCTTGTGCAGGACAAGTCGTTC
AAGAAGTTCGCGAAGCAGTACGCCGACAGCCAGGATCTGTGGTTCAAGGA
GTACGTTGGCCGCATCAAATTTGACATTGGGTACTCCTACTGATAGCTCAATTTTTTTACAGCTTCTCCA
AAGCCGTCGCCACCCTGTTCGAGCTCGGTGTCCCCACAGAGCAGTTCGTCACCCCCGAGCCTTGGACCATCCCCACTGTTGACGAACAAAAGGAGGAGAAGAAAGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCAACGCCTTCCGAAACCCTCTCCGTGCTAGCGTGCGCAGGGCCGCCGCCCAGCCGGCGAGGTTCCAGCTTCGCGTCAACTGCAACCGCAAGTTCTCGACCCCACCACCTCCG
CCTGCGCCCGAAGCAAAGGCGTCCTCCAACGCTGGTCTATACATTGGCCTCGGAGCAGTCGTTGCTGGAGGTCTGGGATACTACCTATACAGCAGTAACGACGCTGTCAACGCGCTCAAG
TCTGGCGCGCAGGTTGCCAAGGTCAAGACCAACACCGCTCCCACCAAGGAAGACTACATCAAG
GTCTACAACAGGATCGCTGAGCTCATTGACGATGCCGGCGAATATGACGATGGTTCT
TACGGGCCCGTTATCCTCCGGCTCGCCTGGCATTCGTCGGGAACATACGACAAGGACTCTAAGACCGGTGGAAG
CAACTATGCTACAATGCGCTTCAATCCCGAATCTAAGCACGGTGCC
AACGCAGGGCTGAACATTGCTCGCGATCTCATGGAGAAGGTCAAAGAGGAATTCCCCTGGATCAGCTACGGTGATCTCTGGACTCTCGGTGGTGTCGCTGCTATTCAG
GAAATGGCTGGC
CCCAAGGTCCCATGGCGCCCTGGCCGTGTTGACGGTGTCGAGGCTCAGGCCACCCCTGACGGTCGCCTTCCCGACGCTACCCAAGGTGCTGACCACCTGAGGAACATCTTCGGCCGCATG
GGATTCAACGACCAGGAGATCGTCGCCCTTTCAGGTGCGCACGCCCTCGGCCGCTGCCATCGCGACCGCTCTGGATTCGAAGGCCCCTGGTCATTCGCGCCCACCACCGTGACCAACGAC
TACTTCCGCCTCCTCTTCGACGAGAAATGGGTCTGGAAGCGCTGGGAGGGCCCGAAGCAGCTCGAGGACAAGAAGACGCGCAGCCTGATGATGCTGCCCACCGATTACGTCCTTGTGCAG
GACAAGTCGTTCAAGAAGTTCGCGAAGCAGTACGCCGACAGCCAGGATCTGTGGTTCAAGGA
CTTCTCCAAAGCCGTCGCCACCCTGTTCGAGCTCGGTGTCCCCACAGAGCAGTTCGTC
ACCCCCGAGCCTTGGACCATCCCCACTGTTGACGAACAAAAGGAGGAGAAGAAAGATTAA

Retrieve as FASTA