Entry information : OsPrx47
Entry ID 1057
Creation 2005-06-16 (Filippo Passardi)
Last sequence changes 2005-06-16 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx47
Name OsPrx47
Class Class III peroxidase    [Orthogroup: Prx093]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx47
start..stop
S start..stop
OsPrx48 603 0 4..331 3..339
SbPrx15 548 0 2..331 3..332
OsPrx46 545 0 23..332 31..340
ZmPrx145 539 0 1..331 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14328148..14328381 234 N° 2 14328759..14329523 765  
join(14328148..14328381,14328759..14329523)


exon

Literature and cross-references OsPrx47
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1P6
DNA ref. GenBank:   NC_008396.1 (14328148..14329520)
Protein sequence: OsPrx47
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (311)
PWM (Da):   %s   34991.52 (32945.4) Transmb domain:   %s   i5-24o
PI (pH):   %s   7.05 (6.76) Peptide Signal:   %s   cut: 22 range:22-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANKLAALLVSFAMLMAAAAGFYTPPSPSTCGLKVGYYHDKCPHAEAIVRGAVGAAILRDPGVGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLAPPNNPSLRGFEVIDAAKTAVEAACPGVVSCADIVAFAARDASFFLSNSRVSFDMPSGRLDGRYSNASRTLDFLPPPKFNLGQLVANFAAKGLSVEDMVVLAGSHTVGRSHCSSFVPDRLAVPSDIDPSFAATLRGQCPASPSSGNDPTVVQDVETPNKLDNQYYKNVLAHKGLFTSDASLLTSPATMKMVLDNANIPGWWEDRFQKAMVKLAAVEVKTGGNGEVRRNCRAVNY*

Retrieve as FASTA  
Remarks chromosome 3; no ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAATAAGCTCGCTGCTCTGCTCGTCTCCTTCGCGATGCTCATGGCGGCGGCCGCCGGCTTCTACACCCCGCCAAGCCCTTCCACGTGCGGACTCAAGGTCGGTTACTACCACGAC
AAGTGCCCGCACGCCGAGGCCATCGTCAGGGGCGCCGTCGGCGCCGCCATCCTCCGCGACCCCGGCGTCGGCGCCGGCCTCATCCGCATGCTCTTCCACGACTGCTTCGTCGAG
GTAAAA
TCATACTCCATCCGTTTTTAAATATTTGACGCAATTGATTTTTTAACACATATTTGATCATTCGTCTCATTAAAAACTTTTGTGAAATATATAAAACTATATATATATATATATATATAT
GTATATTTAACAATGAATCAAATTACAGGAAATGAATTAATAATTACTTAAATTTTTTAAATAAGATAAACAGTTAAACATATTTAAAAAATTTAACGGCGTTAAATATTTAGAAACTAG
AAAGGGAGGGAGTATATATAATGGTGTCACGTTAAGTATGCCAAGTGTGGCCAGTCACATGTCGGAATGTTACTGTCATGGCTGCATTGACACGGTCTTATGACTTGAGTTGACGACATG
AACGCGTGCAGGGATGTGATGCGTCCGTGCTGCTCGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGCCCCGCCCAACAACCCCAGCCTCCGCGGCTTCGAGGTCATCGACGCCG
CCAAAACCGCCGTCGAGGCGGCATGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTCCTTCTTCCTCAGCAACAGCAGGGTGTCGTTCGACATGCCGT
CGGGCCGCCTCGACGGGCGCTACTCCAACGCGTCGCGCACCCTCGACTTCCTCCCGCCGCCCAAGTTCAACCTCGGTCAGCTCGTCGCCAACTTCGCCGCCAAGGGGCTCAGCGTCGAGG
ACATGGTGGTGCTCGCCGGCTCCCACACCGTCGGCCGCTCGCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCCGTGCCCTCCGACATCGACCCGTCGTTCGCCGCCACGCTGAGGGGTC
AATGCCCGGCGAGCCCGAGCTCAGGCAACGATCCCACGGTGGTGCAGGACGTCGAGACGCCGAACAAGCTGGACAACCAGTACTACAAGAACGTGCTCGCTCACAAGGGGCTCTTCACCT
CCGACGCGTCGCTCCTGACGTCGCCGGCCACGATGAAGATGGTGCTGGACAACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCCAGAAGGCAATGGTGAAGTTGGCCGCCGTCGAGG
TGAAGACCGGCGGCAATGGCGAGGTCAGGAGGAACTGCCGGGCTGTGAATTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAATAAGCTCGCTGCTCTGCTCGTCTCCTTCGCGATGCTCATGGCGGCGGCCGCCGGCTTCTACACCCCGCCAAGCCCTTCCACGTGCGGACTCAAGGTCGGTTACTACCACGAC
AAGTGCCCGCACGCCGAGGCCATCGTCAGGGGCGCCGTCGGCGCCGCCATCCTCCGCGACCCCGGCGTCGGCGCCGGCCTCATCCGCATGCTCTTCCACGACTGCTTCGTCGAG
GGATGT
GATGCGTCCGTGCTGCTCGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGCCCCGCCCAACAACCCCAGCCTCCGCGGCTTCGAGGTCATCGACGCCGCCAAAACCGCCGTCGAG
GCGGCATGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTCCTTCTTCCTCAGCAACAGCAGGGTGTCGTTCGACATGCCGTCGGGCCGCCTCGACGGG
CGCTACTCCAACGCGTCGCGCACCCTCGACTTCCTCCCGCCGCCCAAGTTCAACCTCGGTCAGCTCGTCGCCAACTTCGCCGCCAAGGGGCTCAGCGTCGAGGACATGGTGGTGCTCGCC
GGCTCCCACACCGTCGGCCGCTCGCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCCGTGCCCTCCGACATCGACCCGTCGTTCGCCGCCACGCTGAGGGGTCAATGCCCGGCGAGCCCG
AGCTCAGGCAACGATCCCACGGTGGTGCAGGACGTCGAGACGCCGAACAAGCTGGACAACCAGTACTACAAGAACGTGCTCGCTCACAAGGGGCTCTTCACCTCCGACGCGTCGCTCCTG
ACGTCGCCGGCCACGATGAAGATGGTGCTGGACAACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCCAGAAGGCAATGGTGAAGTTGGCCGCCGTCGAGGTGAAGACCGGCGGCAAT
GGCGAGGTCAGGAGGAACTGCCGGGCTGTGAATTACTAG

Retrieve as FASTA