Entry information : HanCcP (hpox3)
Entry ID 10571
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HanCcP (hpox3)
Name (synonym) HanCcP (hpox3)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanCcP
start..stop
S start..stop
SlacCcP01 573 0 7..372 4..371
AthiCcP01 569 0 7..373 4..371
LquiCcP01 569 0 3..371 2..369
SnivCcP01 561 0 8..373 3..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2228710..2229006 297 N° 2 2229072..2229120 49 N° 3 2229179..2229260 82 N° 4 2229315..2229468 154
N° 5 2229525..2229641 117 N° 6 2229703..2229719 17 N° 7 2229780..2229845 66 N° 8 2229896..2230045 150
N° 9 2230100..2230183 84 N° 10 2230239..2230353 115  
join(2228710..2229006,2229072..2229120,2229179..2229260,2229315..2229468,2229525 ..2229641,2229703..2229719,2229780..2229845,2229896..2230045,2230100..2230183,22 30239..2230353)


exon

Literature and cross-references HanCcP (hpox3)
DNA ref. JGI genome:   scaffold_06 (2228710..2230353)
Cluster/Prediction ref. JGI gene:   169836
Protein sequence: HanCcP (hpox3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377
PWM (Da):   %s   41462.85  
PI (pH):   %s   9.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSSFASSFRASARRAAFSSARVPKGPLRSAYRKYSTEPEAPKSKTGLYAGIGALAVGGGLALYFYSSSPDTLATSAKSGAQAVKVAANFVPTKEDYQKVYNKIAEAIDEAGDYDDGSFGPVFLRLAWHSSGTYDKNTSTGGSNYATMRFEPEALHGANNGLNIARGLMEKVKQEFPWISYGDLWTLGGVAAIEMSGPKIPWRAGRIDGFPKDVTPDGRLPDASQGQNHLRDIFYRMGFNDQEIVALSGAHALGRAHTDRSGFEGPWTFSPTTLTNEFYKLLLDEKWIWRKWAGPKQLTDKTTGTLMMLPTDYALVQDKTFKKYVKAYAADQDLFFKDFSAVVSRLFELGIPDSQFTSTEKWTLKSLDEQKEASK

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATCCTCTTTCGCTTCGTCTTTCAGAGCCTCAGCCCGCAGAGCGGCCTTCTCCTCTGCCCGTGTCCCTAAGGGCCCCCTGCGCTCCGCGTACCGCAAGTACTCGACCGAGCCAGAG
GCACCCAAATCTAAGACTGGACTTTACGCTGGTATCGGAGCCCTCGCCGTCGGAGGAGGTCTTGCTCTCTACTTCTACTCGTCCTCGCCGGACACCTTGGCCACGAGCGCAAAGTCGGGT
GCACAGGCAGTCAAGGTCGCCGCCAACTTCGTCCCGACGAAGGAGGACTACCAAAAG
GTGCGTGCCGTGCTCTCCCGAATGTCGTAAGGCGCCTACAATGCTCACTCTTGCGTGATTGTT
AGGTCTACAACAAAATTGCAGAGGCCATTGACGAGGCCGGCGACTATGATGGTTCGCACCATCAGTCGGAGTTTGGATTCTCACGTTCTGGATCTGACTATCATTCTAGATGGTTCTTTC
GGTCCTGTTTTCCTCCGTCTCGCGTGGCACTCGTCGGGTACTTATGACAAGAACACGTCAACCGGCGGCAG
GTGTGTACAATGCACGGAATGTCTTCTGTATGATTGACTTACACATATT
TCCAGCAACTATGCTACCATGCGTTTCGAGCCTGAGGCTCTCCACGGCGCTAACAATGGCTTGAACATTGCTCGCGGCCTCATGGAGAAGGTTAAGCAGGAGTTCCCGTGGATAAGCTAC
GGTGACCTGTGGACTCTTGGTGGCGTGGCTGCTATTCAG
GTATGTGAACTTCTGTCAACGTTTCATCATTTGTTGACGGTTATCTATCCCGTCAGGAAATGTCCGGTCCCAAAATCCCTT
GGAGAGCCGGTCGCATCGATGGCTTCCCTAAGGATGTTACTCCCGACGGTCGTCTTCCCGACGCCTCCCAGGGCCAGAACCATCTTCGGGAT
GTACGTTACTTGCTCATCATTTGACCTG
CCATGCCTGAGGCTCACTATGGCTCGGTTCTAGATCTTCTACCGCATGGGGTATGCGATATCCCTATCCTATTCTTAGAGGCTATCTTTGATTATTATTATTTCACTTAGCTTCAATGAC
CAGGAAATTGTTGCTCTCTCCGGTGCCCATGCACTTGGACGTGCTCACACTGACCG
GTACGGGTCTTTGCTTTGTATGCAGCTCGATCTCCGCTCATATATCGCAGTTCTGGATTTGAGG
GTCCCTGGACTTTCTCCCCAACCACTCTGACCAACGAATTCTACAAGCTTCTGTTGGACGAGAAGTGGATCTGGAGAAAGTGGGCTGGTCCTAAGCAGCTCACAGACAAGACCACGGGCA
CGTTGATGATGCTCCC
GTTCGTATTACACCTGTCTCCCGTGATATGTCGCTTACCTGGTCTATTTGTTAGCACCGACTATGCCCTCGTCCAGGATAAGACTTTCAAGAAGTACGTCAAGG
CCTACGCCGCTGACCAGGATCTCTTTTTCAAGGA
GTATGAATTCCCTAATTGTCTTATCGGCAGCATTGTTAACGGATACGTCCAACAGCTTTTCCGCCGTCGTCTCGCGGCTCTTCGAG
CTCGGTATTCCCGATTCGCAGTTCACTTCCACCGAGAAGTGGACGCTGAAGTCGCTTGACGAGCAAAAGGAGGCGTCGAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATCCTCTTTCGCTTCGTCTTTCAGAGCCTCAGCCCGCAGAGCGGCCTTCTCCTCTGCCCGTGTCCCTAAGGGCCCCCTGCGCTCCGCGTACCGCAAGTACTCGACCGAGCCAGAG
GCACCCAAATCTAAGACTGGACTTTACGCTGGTATCGGAGCCCTCGCCGTCGGAGGAGGTCTTGCTCTCTACTTCTACTCGTCCTCGCCGGACACCTTGGCCACGAGCGCAAAGTCGGGT
GCACAGGCAGTCAAGGTCGCCGCCAACTTCGTCCCGACGAAGGAGGACTACCAAAAG
GTCTACAACAAAATTGCAGAGGCCATTGACGAGGCCGGCGACTATGATGATGGTTCTTTCGGT
CCTGTTTTCCTCCGTCTCGCGTGGCACTCGTCGGGTACTTATGACAAGAACACGTCAACCGGCGGCAG
CAACTATGCTACCATGCGTTTCGAGCCTGAGGCTCTCCACGGCGCTAACAAT
GGCTTGAACATTGCTCGCGGCCTCATGGAGAAGGTTAAGCAGGAGTTCCCGTGGATAAGCTACGGTGACCTGTGGACTCTTGGTGGCGTGGCTGCTATTCAG
GAAATGTCCGGTCCCAAA
ATCCCTTGGAGAGCCGGTCGCATCGATGGCTTCCCTAAGGATGTTACTCCCGACGGTCGTCTTCCCGACGCCTCCCAGGGCCAGAACCATCTTCGGGAT
ATCTTCTACCGCATGGGCTTC
AATGACCAGGAAATTGTTGCTCTCTCCGGTGCCCATGCACTTGGACGTGCTCACACTGACCG
TTCTGGATTTGAGGGTCCCTGGACTTTCTCCCCAACCACTCTGACCAACGAATTCTAC
AAGCTTCTGTTGGACGAGAAGTGGATCTGGAGAAAGTGGGCTGGTCCTAAGCAGCTCACAGACAAGACCACGGGCACGTTGATGATGCTCCC
CACCGACTATGCCCTCGTCCAGGATAAG
ACTTTCAAGAAGTACGTCAAGGCCTACGCCGCTGACCAGGATCTCTTTTTCAAGGA
CTTTTCCGCCGTCGTCTCGCGGCTCTTCGAGCTCGGTATTCCCGATTCGCAGTTCACTTCCACC
GAGAAGTGGACGCTGAAGTCGCTTGACGAGCAAAAGGAGGCGTCGAAGTGA

Retrieve as FASTA