Entry information : HanAPx-CcP03
Entry ID 10573
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HanAPx-CcP03
Name HanAPx-CcP03
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanAPx-CcP03
start..stop
S start..stop
HanAPx-CcP02 674 0 12..537 8..536
HanAPx-CcP01 661 0 15..537 12..536
HC14APx-CcP03 370 6e-123 24..537 26..550
LfluAPx-CcP01 357 1e-117 3..471 1..489
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2011022..2011242 221 N° 2 2010805..2010959 155 N° 3 2010410..2010740 331 N° 4 2010045..2010342 298
N° 5 2009932..2009978 47 N° 6 2009561..2009858 298 N° 7 2009241..2009504 264  
complement(join(2009241..2009504,2009561..2009858,2009932..2009978,2010045..2010 342,2010410..2010740,2010805..2010959,2011022..2011242))


exon

Literature and cross-references HanAPx-CcP03
DNA ref. JGI genome:   scaffold_06 (2011242..2009241)
Cluster/Prediction ref. JGI gene:   150650
Protein sequence: HanAPx-CcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   538 (514)
PWM (Da):   %s   56010.9 (53457.6)  
PI (pH):   %s   4.17 (4.11) Peptide Signal:   %s   cut: 24 range:24-537
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVQSHIAYLAASLLSLPLLSEGYQWPDPIDAIEELYSVTDGLGASNVVFPITPCGFSPLSTSGRQAAAEWIRTAYHDMATADAAAGTGGIDASLGFETDRGENVGPAFNTTMGFLATFQNSHALADLIALGTVLSVRICSGPSVPMRVGRVDATSAGPFGVPEPQQDLSSHTASFAKQGFNVSEMIGLVACGHTIGGVHETEFPTVVTGLINSDNNTSGMQHFDDSFSKFDNHIAVQWVNSSTSDDALATGFNTTMDSDARIFAADNNATMRDLASSNDVFNNRCGELLGRMLDTVPKGVTLTDPIAPVPVKPWNAQLSIDSNGNIQLEGNVIFSSDPAETFDGYTVNIAWTDRNGASCDGCTAPATFQGTSSGTIWDGAVRFFHFNTTIDPAVGFSAFTVQFSTTAGGVVTTADNNGAGFAISDGVMVQPATSCVMSDGTVNIVAVRNDQTVSSASVSFTSAETQVGSVGRLMVPSTASLTRTTSSASSLYDLYSSQFVVGIAASSSFDLSVDLGGTTHTDAFNLVKNLNSC*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGTGCAGAGTCACATAGCATACCTTGCCGCGAGCCTTTTGTCGCTTCCCCTCCTCTCAGAAGGGTATCAATGGCCTGACCCGATTGATGCTATCGAAGAGCTGTACTCTGTCACT
GACGGTCTTGGAGCCAGCAATGTCGTGTTCCCGATCACGCCGTGCGGCTTCTCCCCACTCAGCACCAGTGGCAGGCAGGCCGCTGCTGAATGGATTCGAAC
GTGAGCATCGTGGTCTCCA
CATCGTCCGACAGGCATCTTCGCCGACTGACAACCGCCCGTAGCGCATATCACGACATGGCTACGGCAGACGCAGCTGCGGGCACTGGTGGAATCGACGCCTCTCTCGGTTTCGAGACGG
ATCGTGGAGAAAACGTCGGCCCCGCCTTCAACACCACCATGGGCTTCCTCGCTACGTTCCAGAATAGCCACGCATCGT
GTTGGTTTCATTTTTCTGTTCCGTCATCTGCTGCCCGTTTAC
TCATGCTCGAGCAATTTCTTAGTGGCCGATCTCATTGCTCTCGGCACGGTTCTCTCTGTCCGTATCTGCTCCGGCCCCTCTGTTCCCATGCGCGTTGGTCGCGTCGATGCCACTAGCGCC
GGTCCCTTTGGTGTCCCCGAGCCCCAGCAGGATCTCTCGTCGCACACGGCGTCGTTCGCGAAGCAAGGTTTCAACGTCAGCGAGATGATCGGTCTCGTAGCGTGCGGGCACACGATTGGC
GGTGTCCACGAGACAGAATTCCCGACCGTCGTCACCGGATTGATCAACTCTGACAACAACACGAGCGGGATGCAGCATTTCGATGACTCGTTCTCGAAGTTTGATAACCACAT
GTACGCT
TGTGACCGCTCGTCTCCCCACGCAACGATTCTGACTTAACCTTTGTACGTATGACCACAGCGCGGTGCAGTGGGTCAACAGCAGCACTTCCGACGACGCACTCGCCACCGGTTTCAACAC
CACGATGGATTCTGACGCACGCATCTTCGCCGCCGACAACAACGCGACCATGCGCGACCTCGCCTCCAGCAACGACGTCTTCAACAACCGCTGCGGAGAACTCCTCGGGCGCATGCTCGA
CACCGTCCCCAAGGGCGTGACGCTGACCGACCCCATCGCCCCCGTCCCCGTCAAGCCGTGGAACGCGCAGTTGAGCATCGACAGCAACGGGAATATCCAGTTGGAAGGTAACGTCCGG
GT
GCGTAGGGCTTTATTATTCTTTCGGAAGCGCGACTCCGGCGCTCACGCGTACTGCGCATTCTAGATCTTCTCTTCGGACCCTGCGGAGACCTTCGATGGCTACACGGTCAAGTAAGTTCT
TCCAGGACCGCAGTGTCTTTACGAGCGGAATGTCTGACTTCTTTCCTCTTCTTCTCTCGATCAGCATCGCCTGGACAGACCGCAACGGCGCGTCGTGCGACGGCTGCACCGCACCCGCGA
CGTTCCAAGGGACTTCTAGCGGCACGATCTGGGACGGCGCGGTCCGGTTCTTCCACTTCAACACCACGATCGACCCCGCCGTCGGCTTCTCCGCCTTCACGGTCCAGTTCTCGACCACCG
CCGGGGGCGTGGTGACCACAGCAGACAACAACGGCGCGGGCTTCGCGATCAGCGATGGCGTCATGGTGCAGCCCGCGACCAGCTGTGTCATGTCTGACGGCACCGTCAATATCGTCGCTG
CG
GTAAGCATTTCTCATCCTTCCCCCCTGCGAACTAGTGCTTATCGTCCGGGCGACAGGTGCGCAACGACCAGACGGTCTCGTCCGCGTCAGTCAGCTTCACCTCCGCCGAGACGCAGGT
GGGCTCGGTCGGCCGTCTGATGGTGCCGTCGACGGCGAGCCTGACGCGGACCACGAGCTCCGCGTCGAGCCTGTACGACCTGTACTCCTCGCAGTTCGTCGTTGGGATCGCCGCCAGCTC
GTCGTTCGACCTCTCTGTCGACCTCGGGGGCACGACGCACACGGACGCGTTCAACCTTGTGAAGAACCTCAACAGCTGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGTGCAGAGTCACATAGCATACCTTGCCGCGAGCCTTTTGTCGCTTCCCCTCCTCTCAGAAGGGTATCAATGGCCTGACCCGATTGATGCTATCGAAGAGCTGTACTCTGTCACT
GACGGTCTTGGAGCCAGCAATGTCGTGTTCCCGATCACGCCGTGCGGCTTCTCCCCACTCAGCACCAGTGGCAGGCAGGCCGCTGCTGAATGGATTCGAAC
CGCATATCACGACATGGCT
ACGGCAGACGCAGCTGCGGGCACTGGTGGAATCGACGCCTCTCTCGGTTTCGAGACGGATCGTGGAGAAAACGTCGGCCCCGCCTTCAACACCACCATGGGCTTCCTCGCTACGTTCCAG
AATAGCCACGCATCGT
TGGCCGATCTCATTGCTCTCGGCACGGTTCTCTCTGTCCGTATCTGCTCCGGCCCCTCTGTTCCCATGCGCGTTGGTCGCGTCGATGCCACTAGCGCCGGTCCC
TTTGGTGTCCCCGAGCCCCAGCAGGATCTCTCGTCGCACACGGCGTCGTTCGCGAAGCAAGGTTTCAACGTCAGCGAGATGATCGGTCTCGTAGCGTGCGGGCACACGATTGGCGGTGTC
CACGAGACAGAATTCCCGACCGTCGTCACCGGATTGATCAACTCTGACAACAACACGAGCGGGATGCAGCATTTCGATGACTCGTTCTCGAAGTTTGATAACCACAT
CGCGGTGCAGTGG
GTCAACAGCAGCACTTCCGACGACGCACTCGCCACCGGTTTCAACACCACGATGGATTCTGACGCACGCATCTTCGCCGCCGACAACAACGCGACCATGCGCGACCTCGCCTCCAGCAAC
GACGTCTTCAACAACCGCTGCGGAGAACTCCTCGGGCGCATGCTCGACACCGTCCCCAAGGGCGTGACGCTGACCGACCCCATCGCCCCCGTCCCCGTCAAGCCGTGGAACGCGCAGTTG
AGCATCGACAGCAACGGGAATATCCAGTTGGAAGGTAACGTCCGG
ATCTTCTCTTCGGACCCTGCGGAGACCTTCGATGGCTACACGGTCAACATCGCCTGGACAGACCGCAACGGCGCG
TCGTGCGACGGCTGCACCGCACCCGCGACGTTCCAAGGGACTTCTAGCGGCACGATCTGGGACGGCGCGGTCCGGTTCTTCCACTTCAACACCACGATCGACCCCGCCGTCGGCTTCTCC
GCCTTCACGGTCCAGTTCTCGACCACCGCCGGGGGCGTGGTGACCACAGCAGACAACAACGGCGCGGGCTTCGCGATCAGCGATGGCGTCATGGTGCAGCCCGCGACCAGCTGTGTCATG
TCTGACGGCACCGTCAATATCGTCGCTGCG
GTGCGCAACGACCAGACGGTCTCGTCCGCGTCAGTCAGCTTCACCTCCGCCGAGACGCAGGTGGGCTCGGTCGGCCGTCTGATGGTGCCG
TCGACGGCGAGCCTGACGCGGACCACGAGCTCCGCGTCGAGCCTGTACGACCTGTACTCCTCGCAGTTCGTCGTTGGGATCGCCGCCAGCTCGTCGTTCGACCTCTCTGTCGACCTCGGG
GGCACGACGCACACGGACGCGTTCAACCTTGTGAAGAACCTCAACAGCTGCTGA

Retrieve as FASTA