Entry information : EcamGPx[P]10 ( EcC007915.40)
Entry ID 10577
Creation 2012-02-28 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-08 (Christophe Dunand)
Peroxidase information: EcamGPx[P]10 ( EcC007915.40)
Name (synonym) EcamGPx[P]10 ( EcC007915.40)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx[P]10
start..stop
S start..stop
EglGPx[P]10 199 1e-68 1..97 1..97
SiGPx01 156 1e-50 1..97 67..161
MdGPx06 156 1e-50 1..97 67..161
SpGPx01 155 1e-50 1..94 67..158
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..114 114 N° 2 298..477 180  
join(1..114,298..477)


exon

Literature and cross-references EcamGPx[P]10 ( EcC007915.40)
Protein sequence: EcamGPx[P]10 ( EcC007915.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97
PWM (Da):   %s   10667.5  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LAITCNQFGAQQPGWTNVEILQFACTRFMAEYPILDKLVAVKGQNAAPLYAFLKSSKGGLFGDDIKWNFSKFLIDKEGNVVDRYAPTTSPLSIEVRV*

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (Very big 5' end is missing). Incorrect prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAGCAATCACGTGCAACCAGTTTGGAGCTCAGCAGCCGGGGTGGACAAATGTGGAGATCCTACAATTTGCTTGCACTCGATTCATGGCCGAATATCCCATTCTTGATAAGTTGAAAGAA
CAGATACATACGCTGAGCGTGTTGCGAACTACTTTTCGTTCTAGTTCTCTAGAAAGTTTTTCTTGGAGTTGTATCTGCAGTTCCCTCATATTTCCTAGCGACTGGTAATTTGCAGCTTGA
GTCAAAAAAGGTCAAAAAACAAAGTGAGGAGGAAGAATCTGATTGCTTTTTCTATAAGTTGCCGTGAAGGGGCAAAATGCCGCCCCTCTCTACGCGTTCCTGAAATCAAGCAAGGGCGGA
CTCTTTGGGGATGACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTTGATCGCTATGCGCCCACTACTTCTCCTCTTAGCATCGAGGTAAGAGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAGCAATCACGTGCAACCAGTTTGGAGCTCAGCAGCCGGGGTGGACAAATGTGGAGATCCTACAATTTGCTTGCACTCGATTCATGGCCGAATATCCCATTCTTGATAAGTTGGTTGCC
GTGAAGGGGCAAAATGCCGCCCCTCTCTACGCGTTCCTGAAATCAAGCAAGGGCGGACTCTTTGGGGATGACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTC
GTTGATCGCTATGCGCCCACTACTTCTCCTCTTAGCATCGAGGTAAGAGTCTGA

Retrieve as FASTA