Entry information : OsPrx48
Entry ID 1058
Creation 2005-06-16 (Filippo Passardi)
Last sequence changes 2005-06-16 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx48
Name OsPrx48
Class Class III peroxidase    [Orthogroup: Prx093]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx48
start..stop
S start..stop
OsPrx47 603 0 3..339 4..331
OsPrx46 540 0 14..339 19..339
SbPrx15 538 0 26..339 19..332
ZmPrx145 533 0 2..339 3..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14337998..14338255 258 N° 2 14338372..14339133 762  
join(14337998..14338255,14338372..14339133)


exon

Literature and cross-references OsPrx48
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1P5
DNA ref. GenBank:   NC_008396.1 (14337998..14339130)
Protein sequence: OsPrx48
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339
PWM (Da):   %s   35631.98  
PI (pH):   %s   6.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLAALLVSLAMLMAAVTAARVERAGAGFYTPPSPSTCGLKIGYYHDKCPHAEAIVKGVVAAALHRDPGVGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLAPPNNPSLRGFEVIDAAKDAVEAACPGVVSCADIVAFAARDASFFLSDSRVSFDIPSGRLDGRYSNASRALDFLPPPTFNLGQLVANFAAKGLSVEDMVVLSGAHTIGLSHCSSFVSDRLAVASDIDPSFAAVLRAQCPASPSSSNDPTVVQDVVTPNKLDNQYYKNVLAHRALFTSDASLLASPATAKMVVDNANIPGWWEDRFKTAMVKMAAVEVKTGSNGEIRRHCRAVN*

Retrieve as FASTA  
Remarks chromosome 3; no ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGGCTGGCTGCTCTGCTCGTCTCCTTAGCGATGCTCATGGCGGCGGTGACGGCAGCCCGGGTAGAAAGAGCGGGCGCCGGCTTCTACACACCGCCAAGCCCTTCCACCTGCGGC
CTCAAGATCGGCTACTACCACGACAAGTGCCCGCACGCCGAGGCCATCGTCAAGGGCGTCGTCGCCGCCGCCCTCCACCGCGACCCCGGCGTCGGCGCCGGCCTCATCCGCATGCTCTTC
CACGACTGCTTCGTCGAG
GTACGTACGTACGTACATTCATGTGTACGATATGATTGCTCGTTTCTGATCATCTTTGTGGCCGCGTGCATGACACTTGACACGTCTACATCGCCATTGCCG
ACATGTGGGTGCAGGGATGTGATGCCTCCGTGCTGCTCGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGCCCCGCCAAACAACCCCAGCCTCCGCGGCTTCGAGGTCATCGACG
CCGCCAAGGACGCCGTCGAGGCGGCGTGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTCCTTCTTCCTCAGCGACAGCAGGGTGTCCTTCGACATTC
CGTCGGGACGCCTCGACGGGCGCTACTCCAACGCGTCGCGCGCCCTCGACTTCCTCCCGCCGCCGACCTTCAACCTCGGTCAGCTCGTCGCCAACTTCGCCGCCAAGGGGCTCAGCGTCG
AGGACATGGTGGTGCTCTCCGGCGCCCACACCATCGGCCTCTCACACTGCTCGTCCTTCGTCTCCGACCGCCTCGCCGTCGCCTCCGACATCGACCCGTCGTTCGCCGCTGTCCTACGAG
CCCAATGCCCGGCGAGCCCGAGCTCGAGCAACGACCCGACGGTGGTGCAGGACGTGGTGACGCCCAACAAGCTGGACAACCAGTACTACAAGAACGTGCTCGCGCACAGGGCGCTCTTCA
CCTCCGACGCGTCGCTCCTGGCGTCGCCGGCGACGGCAAAGATGGTGGTGGACAACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCAAGACGGCCATGGTGAAGATGGCCGCCGTCG
AGGTGAAGACCGGCAGCAACGGCGAAATCAGGAGACACTGCCGGGCTGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGGCTGGCTGCTCTGCTCGTCTCCTTAGCGATGCTCATGGCGGCGGTGACGGCAGCCCGGGTAGAAAGAGCGGGCGCCGGCTTCTACACACCGCCAAGCCCTTCCACCTGCGGC
CTCAAGATCGGCTACTACCACGACAAGTGCCCGCACGCCGAGGCCATCGTCAAGGGCGTCGTCGCCGCCGCCCTCCACCGCGACCCCGGCGTCGGCGCCGGCCTCATCCGCATGCTCTTC
CACGACTGCTTCGTCGAG
GGATGTGATGCCTCCGTGCTGCTCGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGCCCCGCCAAACAACCCCAGCCTCCGCGGCTTCGAGGTCATC
GACGCCGCCAAGGACGCCGTCGAGGCGGCGTGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTCCTTCTTCCTCAGCGACAGCAGGGTGTCCTTCGAC
ATTCCGTCGGGACGCCTCGACGGGCGCTACTCCAACGCGTCGCGCGCCCTCGACTTCCTCCCGCCGCCGACCTTCAACCTCGGTCAGCTCGTCGCCAACTTCGCCGCCAAGGGGCTCAGC
GTCGAGGACATGGTGGTGCTCTCCGGCGCCCACACCATCGGCCTCTCACACTGCTCGTCCTTCGTCTCCGACCGCCTCGCCGTCGCCTCCGACATCGACCCGTCGTTCGCCGCTGTCCTA
CGAGCCCAATGCCCGGCGAGCCCGAGCTCGAGCAACGACCCGACGGTGGTGCAGGACGTGGTGACGCCCAACAAGCTGGACAACCAGTACTACAAGAACGTGCTCGCGCACAGGGCGCTC
TTCACCTCCGACGCGTCGCTCCTGGCGTCGCCGGCGACGGCAAAGATGGTGGTGGACAACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCAAGACGGCCATGGTGAAGATGGCCGCC
GTCGAGGTGAAGACCGGCAGCAACGGCGAAATCAGGAGACACTGCCGGGCTGTCAATTAA

Retrieve as FASTA