Entry information : EcamPrxII02 ( EcC014359.10)
Entry ID 10584
Creation 2012-02-28 (Qiang Li)
Last sequence changes 2013-10-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-08 (Christophe Dunand)
Peroxidase information: EcamPrxII02 ( EcC014359.10)
Name (synonym) EcamPrxII02 ( EcC014359.10)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrxII02
start..stop
S start..stop
EgrPrxII02 394 1e-142 1..196 1..196
EguPrxII02 391 9e-142 1..196 1..196
EglPrxII02 338 2e-120 1..196 1..195
CclPrxII05 328 2e-116 1..196 24..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..201 201 N° 2 308..337 30 N° 3 1690..1848 159 N° 4 2459..2553 95
N° 5 2731..2836 106  
join(1..201,308..337,1690..1848,2459..2553,2731..2836)


exon

Literature and cross-references EcamPrxII02 ( EcC014359.10)
Protein sequence: EcamPrxII02 ( EcC014359.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   20711.65  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLLAKRSSSSVLGGLWTAAARTYASVAVGGDIVSAAPGVSLQKARSWDEGVSSKFATTPVKDIFEGKKVVIFGLPGAYTGVCSQQHVPSYKNNIDKFKAKGIDSVICVAVNDPYTMNGWAENLKAKDAIEFYGDFDASFHKSLDLTKDLSAALLGLRSERWSAYVEDGKVKALNVEEAPSDLKVSGAEVLLGQI

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCCGTCCTCGGCGGCCTATGGACGGCCGCGGCCAGGACCTACGCCTCGGTCGCCGTCGGCGGCGACATCGTCTCCGCGGCGCCGGGC
GTCTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTGTCAAGGATATCTTCGAG
GTTGGTCTTCGATTTCTTGCTGATTGCTTCATTCGCAGT
GGAAGTTCAGCTTCTGAATTTTTACTAATTTGCTGTGCCTGGGCTTCATTCGGACATGGGATTTCAGGGCAAGAAGGTGGTGATTTTCGGACTCCCGGTGAGTGAACTCTTCGCTCTTTC
ATGTCTGTAGTTTCGTGGGAAATAATCGAGCCCTTTTTGTCTTCTGGGCAGTTGATTCATGGGTGTCGATTGCAGCAAGCAATGTCTTCCTTATTTAGTGCTAACTTAGCGGCGAAGATT
GCTCTTTTTTTCCGACATCTGAAATGGTTATATAAGACAGAGGAGATGCGTCTGAATTTTCTAATGGGAATCGTTTCAATTATTCGTTTAATGGGTTGCTTTCATGTTCTCGCCGTATTG
GTTGGTATCATGGTGCGGAGGCTTGAATAGATCGATAGATTATGATATGCAGCTAGACTTTGCCAATTTCCATGAGAGAGTCGTGTTATGCTCTTTGATAGCAAAAATAGAAATCTTTCT
TTTGATCTCTGCAAAGTTCCTATTTTCAAAAAGCTGGAAGGAGTATATAGAAATCTGGACAAGAGCCTAATAAATGACATCATATTGAAATTTAGTGTTCGACACTTTTATGAAGTATTG
TCCCATTCTTCGAACATTTATTGTACTTGTGAAAAGGATAGGTGCTGGGTTCCTAGCGGAAACTTCAAAGGCATTGCAGTCCATAATATGAGATGCATGCTAGTCCACCATGTTTAGGTT
CTGTGGTTCACTTACTTCATGATCCTAGCTGCATCATTGAGGAAAATTTGGACATAGAGGTGACTATCTAACCAACTTGTTATAACTTCCAACCAAAATGAAAGTAAAAAGGAAAAAAAG
ATTTGGATTTTAGACAATTTTAAATAAGTTTCGCCAGACACTAATGTTATAATTCTACTTTTTGATATCGAGGTGTTCAATACTAGATAAAAGTCAATCTAACACACTAAAAGCAAAAAA
TAGAAATAAGAAGTTGAAAAACATGTTGCCTTGAACAAAACTTGCACAACAAAGTTAGTATGTTTAGAGAAAACTTTGTTGTTGTCTGGTAATAATGTAGTTTGATGTGATGCCATTTTT
AATCTTGCATCTTACCTCTTACAGCATTTCTAGTTTTATATACACCATATTTCTATTTTTTAATTTGTACCCAAGTCCTTTATGCTGAATTCATCTTGCATCTAATGCCCANNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTGCATTATCTTGCCATTTTAACCTCGGAAACTGAGACACATTAACTTTAAGAAGATTTGACATATTG
AAGCTGTAGCTACTGCAGGTCAAATAATAAAGGATAGCAAGTTGATATTTAACAATTCTTTATTGGTTTTTCTTTTTCTTCTTTCTCTTCGCGCTTTCTATTCAAATCTTCATATTTGAT
GTCTCCCAGGGTGCATACACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAGACTCTGTGATTTGTGTGGCTGTCAATGAC
CCCTACACCATGAATGGCTGGGCTGAAAATCTCAAAGCAAAAGATGCT
GTAAGTTACTAATTTTGAAACCCAATTCTTTGCTTCTAGAGATGAACTACTGTGTCTGCCTTACATATTTGC
GTGTTGAGTTCCTTGCCTCATCTTTTTGATAATTTCTTGAGGAAAAATTTATTGATTGTTGTGAGGATTTCTGGTATTGCCTCACATTTCTTCCTGCACCTTGTAGAACATCAATACGAG
GTTACTTTCTTTTGTTTTTATTTTCTTCAAGAGGATGACTCACCTTTATGTCACAACGTTCTGTTTGCAAAACTGTAAATGCATGTTGGTAGGACATGCAGTGAACACAATCAGAGGTGA
AATGGCAGTAGAGCAGCTATAATTCTTACCTCAGTTTTATTATTAACGCCATCTTTAAAGAAAGTGTACTACTACAGAAGTTTCTTGGGCAAAACAATCCATTTCCAGAGATGCAAATGA
GGCTTCTTTTATGAGAGTATGTGTGTGACACTGTGAAGGAATGTGGTTCATGTATGCACAAGAAGGAAAGCTTGATTTTTACCTTGTTTGTGAAATTCTATCATCTCTGCCTCCCCACAT
TTTAAAGAGAAAGAAGGCTCTGACATGAGCTTGTGCTTGTTTTTCTTAATCATAACAGATCGAATTCTATGGGGATTTTGATGCTAGCTTCCACAAGAGCTTGGACTTGACTAAAGATCT
CTCAGCAGCTTTGCTTGGACTTCGCTCTGAAAG
GTATGCCCTAGGCCCTAATAAGTTAATATTGGACATCAAACACCTCCTTGAATCTCCTTCCGTCATTTTTACCTTTGGACCATCACT
TTATGGATGAAATGCCTAATTAAATGAGCAGTTTGTCCTTGGTCTACTCCTTTTTTTTTTTTGGGTAATCAAATGGCTGCTCTGGTGTAGATGGTCAGCTTATGTGGAGGACGGGAAAGT
GAAGGCTCTCAATGTGGAAGAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTCTTCTGGGACAGATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCCGTCCTCGGCGGCCTATGGACGGCCGCGGCCAGGACCTACGCCTCGGTCGCCGTCGGCGGCGACATCGTCTCCGCGGCGCCGGGC
GTCTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTGTCAAGGATATCTTCGAG
GGCAAGAAGGTGGTGATTTTCGGACTCCCGGGTGCATAC
ACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAGACTCTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATGAATGGC
TGGGCTGAAAATCTCAAAGCAAAAGATGCT
ATCGAATTCTATGGGGATTTTGATGCTAGCTTCCACAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGCTTGGACTTCGCTCT
GAAAG
ATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGGAAGAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTCTTCTGGGACAGATATGA

Retrieve as FASTA