Entry information : OsPrx49
Entry ID 1059
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx49
Name OsPrx49
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx49
start..stop
S start..stop
SiPrx146 520 0 30..348 24..345
SbPrx04 512 0 39..348 44..357
ZmPrx92 492 2e-176 25..348 24..355
EglPrx163 355 7e-123 16..348 6..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20064750..20065001 252 N° 2 20065542..20065730 189 N° 3 20066313..20066511 199 N° 4 20069479..20069885 407
join(20064750..20065001,20065542..20065730,20066313..20066511,20069479..20069885 )


exon

Literature and cross-references OsPrx49
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1P4
DNA ref. GenBank:   NC_008396.1 (20064750..20069882)
Protein sequence: OsPrx49
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (316)
PWM (Da):   %s   37812.49 (34354.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   9.04 (8.55) Peptide Signal:   %s   cut: 33 range:33-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVRVLLPPPRRWFLLSSLLLVVAAAVPVVHGYGGGGGLTVGFYKESCPEAEKIVRKVVAAAVHDDPTTTAPLLRLHFHDCFVRGCEGSVLINSTKKNTAEKDAKPNHTLDAYDVIDAIKEKLEHKCPATVSCADILAIAARDAVSLATKAVRQGRWSKDGNLYEVETGRRDGRVSSAKEAVTYLPDSFDGIRRLITRFASKGLSLKDLAVLSGAHALGNTHCPSIAKRLRNFTAHHNTDPTLDATYAAGLRRQCRSAKDNTTQLEMVPGSSTTFDATYYGLVAERKGMFHSDEALLRNDVTRGLVYEYMRSEESFLRDFGVSMVNMGRVGVLTGSQGEIRRTCALVN

Retrieve as FASTA  
Remarks chromosome 3. 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGCGCGTGCTTCTTCCTCCTCCTCGCCGGTGGTTCTTGCTTTCTTCTCTGCTGCTGGTGGTGGCGGCGGCTGTTCCCGTCGTCCATGGATACGGCGGCGGCGGTGGGCTGACG
GTCGGGTTCTACAAGGAGTCGTGCCCGGAGGCGGAGAAGATAGTGCGCAAGGTGGTGGCGGCGGCTGTCCATGACGACCCGACCACCACCGCGCCGCTGCTCAGGCTTCACTTCCACGAT
TGTTTCGTCAGG
GTAAACTAAAATGCATTATTACTACTTGTCTCGTTATTTTCTTTTTATAGATTGAAGTCCAAATGTCATCTTTACTCTTTTACTACTGATTCAAAGGTTTCATTATTC
AAAGCTAAAAAAAAAAAGGGTTTAACTGTGAGCTAGTGAAGGTGAAAAAGTAAAAAGGAGGAGAGGATAAGATATGTGGGTTAGCTAGATTCCTTCAAAATGGGCCTTTTTTCTGCATCC
TGTTTGATTGCCTTTTTGAGTGAAATGGCATCCAAAGCCGGTCTAAAATGATGAGATGCAGTCCATCATCAGTCGTCCACAAACTAAAGTGGTGACCCTCTGAAACTTTCTGTATAAAAT
AATCATAAAAAAACACTAGTAATCCACTCACAAGCCCTGACAAGTGCCAAATTTTTTCTTTCCACAAGACAAACATCCGCAATGCCGTAGATGAAGTGGTCTGTACAAATTAAAATGTGC
AAATTAGCATTCTTTCAAGACCATGATTGTTTGATCGATATGTTACCATGGAATTGGTCGATGAACGTACAGGGGTGTGAAGGATCGGTGCTGATCAACTCGACCAAGAAGAACACGGCG
GAGAAGGACGCCAAGCCGAATCACACGCTGGACGCGTACGACGTCATCGACGCAATCAAGGAGAAGCTGGAGCACAAGTGCCCCGCTACCGTCTCCTGCGCCGACATCCTCGCCATTGCT
GCCAGAGACGCCGTCTCCTTG
GTAATCACTAGTACCTCCGTTTTAAAATAAATATAGTCGTGAGTATCCGTGTCTAATGTTTAATCATCCGTCTTATTAAAAAAATTAGTCACACATAAA
GTACTAGTATTTACCCTCCGCTTTCCAATGTAAGTCATTTTAATATTTCCTATATTTATATTGATGTTAATGAATCTAAATATATATTAATATTAATATGAATATGACAAATGCTAGAAT
GACTTACATTGTGAAACGATGGAGTATGTTTTATCACCTAATAATAATAAAAAATACTAATCATAAAATATTTTTAAATAAGAAGAACAATCGAATGTTGGAGATTAATAGTATAAAACT
GGACTTATTTTGGGACGGAGGGAGTAGTAATTAATGAAGATTATTAATTAATAATTCCATCTCATACCTTAATATGTTGAAAAATTTTATCACAATTTTAATATAATTTTTAATATAAAG
TTTGATCTCTTTTAGTACTGGAGATATCGTGAGAGATCATTTTACACTTAAAAAAATATTGTAACTCTCAATACCTTATCAGAAACTGTAAAATCACTCTAAGATGCAAGTCTTTGTGCT
TAGGCAACAAAGGCGGTGAGGCAAGGACGGTGGAGCAAGGACGGCAACTTGTACGAGGTGGAGACCGGCCGGCGAGACGGCCGCGTGTCGAGCGCCAAGGAGGCGGTGACCTACTTGCCC
GACTCCTTCGATGGAATTCGCAGGCTCATCACCAGGTTTGCTTCCAAGGGCCTCAGCCTCAAGGATCTGGCTGTTCTGTCAG
GTACGTAGCCACATATTTAATCTCCATTCAGCCTAGCT
TTCAGGCGTCACACATACAGTTTCTTGCAGACCAAAAGTGTTCAAACTTCACCTGATGAGATATTGAGGATATGTTTAGTTCACGTCAAAATTGGAAGTTTCGTTAAAATTGGAACTATA
TGACGGAAAAGTTTGAAGTTTGTATGTGTAGGAAAGTTTTGATGTGATGAAAAAGTTGGAAGTTTGAAAAAAAAAATTAGAACTATACTCGGTCTGAAATAACATATATAGTAAAAATTT
TGAATTGGCTTCATGTGAAAACATTAAAAGATTCTAGTGGATTCACCACGATAGCATTCCAATAGTGGCAAAATTAGACCATGAGTAGTTTCCTGTTCAGGACAACATGTAGTTGCCGAT
ATATCACCCGTGCACTTCCAATCATTACTTATACAAATATGCAAGGAAAAAAATATAAAGGAGATAGTATGACATCATCTCAGTGAAAACATAATGATACCGTTTTCACACCACTGAATT
TTTTTAGAAAAATATAGCAATATTTTTAATCCAAAACAAACATATTATCGTAATATATACAATATTAAATTTAGTAAAACTAATTTATTTTGTGTTATAGATGTTGCTATATTTCTCTAC
AAACTTAGTTAAATTTTAGAAAAATGATTAAAAAAATCAAAACGTCTTATAATATAAAATGGATTGAGTAGTTTTTTACGCGGTTGTTGGGCATCCAGTTCTGCGGCAATGGCTGCAGCA
GTCAGGTAGCTTACTTGTGCCTGTGTACTCATAGTGGTTGCAGCTGCTCCGTTGTCTGGCAACATGAATAGGGCCTATACTAAGAGTGAAATATTCCAAAATGTAACAAATTGACAACGA
AGTGGTCAGTACTGGTGATATGTATTTAATTACTTTCCAATATTTTTGATTGAATTATTTCAGGTCTAAACCCCCTGTTCAGTTAAAAATTTTGAATAACAACCATGTATATGTAATTTT
TGTCATGAGGTCGATATGATGCCCTACTTGAAACCCATTGTAGTTTTGTATGACAATGTCGACCGTCAAAGCTAGTATCAGACAGAGCATGAAGTCACATGTCTCTTTTACTACTGGCCT
ATTGATGTCGCGTGTAGGAGAAACTATTACGATTTGAGAAAGGGCCTGTAGAGCATGAAGTCACATGTCTCTTTTACTACTGGCCTATTGATGTCGCGTGTAGGAGAAACTATTACGATT
TGCGAAAGGGCCTGTAGTCTGTAGCCTAGTGTTTACGAGAGCCTCAGTAGCATCTAAGGTTCTAGGTTCGACTCTCTATGAGAGCGAATTTTCTAGGATTTAACGGTGTTGTGCTTTCAG
TGGTAGGCGACGTACCCGTCGACAGCGAGGCGCCTGTGGTGACTTCGTCAATATCAAGGATTCGCCGGCCTAGTCTTCGAAGATGCTCATAGGGGTAGGGTTTACGTGCGTACGTTCATA
GGAGTAAGTGCACGTGCGTTGTGAGTGTCTGTGTTGTACTGTGTAATTTCAAAAAAAAAAAGAAACTATTACGATTTGTTCAAAGTATAGAACAACATCACACATTTCAAGGAATAATCA
ATTACTAATAAGGGGATAAACGGAATATGGTCGGTCTCAAAATTGCCAAAATGAAAATCAGACGCAGAAAATATAAAAAATCAAAGAATGCTGCAGTACAGACGTAAAGTACCACTGGTG
GAGAAATGCTTTTTAGTCCTAGTTCGTAACCCCCTGTAGTCCCGGTTTTTCAACCGGGACTACGAATCCGGGACTAAAGATCGCTATCTTTAGTCCCGGTTCAAATAACCGGGACTAAAA
ATCAATCTTTAGTCCCGGTTGATGTTACCAACCGGGACTAAAGATGGAAGAATCTTTAGTCCCGGTTGATAACACCAACCGGGACTAAAGATATTTTTTCTTTTTTTTTTCTGCTTTTAA
TATTGAATATTGATTTCACACCATCCCCTCCCATATCCAAATCATCACATATTACAGAACATCTCCAAATCCTCAAACAAATCATCTCCAAATACATCACAAACTCTTAAAAAAATTACA
TCACAGGGTTCTAAAAAATTCATCACAGATTCACATCTCACACAAAAATACATCACAGATTCACATCTCAAAAAAAAAAAGAAAAAAAATCCGGCCGGCGGCCACTGCCGCCTCCCCTCC
TCGCATCCGCGCCGGCCGGCCAGCGCCGCGTCGGTCGCCGCCGAGCGGCCGCCCACCGCAGCCGCCGCCTCCGCGCGGCCCCCGGCACCGCCGCGCGGCCTCCCGCGCCGCCGCGCCGGC
CGCCCACCGCCGCCGCCGCGCGGCCCCCCGCGCTGCCGCACCGGCCGCCGCGCAGGCCGCCTCCGCGCCGTCCCCCGCGTCGCCGCCTCCGCGCCGACCGCCTGCACTGTGGTGAAGGAA
AAAAGGAAGGAGAGGAGGGGAGTTAGAGATAAGGAAAGAGATAAGAAGTTAGAGAGGAAAAAAAGAGATAGAGGGAGGAGTTTGTTGTGTGGACGGGAAAAGAGGATCGGTACTATGGAT
TATATAGTGTGTTTTGATTTTTATTCTCGGTTAGTAACACCAACCGGGACTAAAAATAGGTTTTTAGTCCCGGTTGGTGTTACTAACCGGGACTAAAGATCATAGGGCCCTGACACAGCC
TGACATGGAATCAACCGGGACTAAAAATGAACTTTAGTCCCGGTTGGAGTTACCAACCGGGAGTAAAGATGATTTTTAGTCCCGGTTGGTAACAACAACCGGGACTAAAGATCTTCCTCT
TATTAACCGGGACTAAAAATCATTTTTAGTCCCGGTTTTTAATGGAACCGGGACTATTGTGGATATGGGTCGACCGACCAAAGATGGTTTCTCTACCAGTGTACCCTAGCATTCTTAAAG
ATTATTTAACTTTGTTTATATTCTTATGCATGACACTTTGAACTTTCAGGCGCCCACGCGCTGGGCAACACGCACTGCCCATCGATAGCGAAGCGTCTGCGCAACTTCACGGCGCACCAC
AACACGGACCCGACCCTGGATGCGACGTACGCCGCGGGGCTGCGGCGGCAGTGCAGGTCGGCCAAGGACAACACCACCCAGCTGGAGATGGTGCCCGGCAGCTCGACCACCTTCGACGCC
ACCTACTACGGCCTCGTCGCCGAGCGGAAGGGCATGTTCCACTCCGACGAGGCGCTGCTCCGGAACGACGTTACCAGGGGGCTCGTCTACGAGTACATGAGATCGGAGGAGAGCTTCCTC
CGGGACTTTGGCGTGTCAATGGTGAACATGGGCAGGGTGGGCGTGCTCACCGGCAGCCAGGGGGAGATCCGGAGGACATGCGCCCTTGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGCGCGTGCTTCTTCCTCCTCCTCGCCGGTGGTTCTTGCTTTCTTCTCTGCTGCTGGTGGTGGCGGCGGCTGTTCCCGTCGTCCATGGATACGGCGGCGGCGGTGGGCTGACG
GTCGGGTTCTACAAGGAGTCGTGCCCGGAGGCGGAGAAGATAGTGCGCAAGGTGGTGGCGGCGGCTGTCCATGACGACCCGACCACCACCGCGCCGCTGCTCAGGCTTCACTTCCACGAT
TGTTTCGTCAGG
GGGTGTGAAGGATCGGTGCTGATCAACTCGACCAAGAAGAACACGGCGGAGAAGGACGCCAAGCCGAATCACACGCTGGACGCGTACGACGTCATCGACGCAATCAAG
GAGAAGCTGGAGCACAAGTGCCCCGCTACCGTCTCCTGCGCCGACATCCTCGCCATTGCTGCCAGAGACGCCGTCTCCTTG
GCAACAAAGGCGGTGAGGCAAGGACGGTGGAGCAAGGAC
GGCAACTTGTACGAGGTGGAGACCGGCCGGCGAGACGGCCGCGTGTCGAGCGCCAAGGAGGCGGTGACCTACTTGCCCGACTCCTTCGATGGAATTCGCAGGCTCATCACCAGGTTTGCT
TCCAAGGGCCTCAGCCTCAAGGATCTGGCTGTTCTGTCAG
GCGCCCACGCGCTGGGCAACACGCACTGCCCATCGATAGCGAAGCGTCTGCGCAACTTCACGGCGCACCACAACACGGAC
CCGACCCTGGATGCGACGTACGCCGCGGGGCTGCGGCGGCAGTGCAGGTCGGCCAAGGACAACACCACCCAGCTGGAGATGGTGCCCGGCAGCTCGACCACCTTCGACGCCACCTACTAC
GGCCTCGTCGCCGAGCGGAAGGGCATGTTCCACTCCGACGAGGCGCTGCTCCGGAACGACGTTACCAGGGGGCTCGTCTACGAGTACATGAGATCGGAGGAGAGCTTCCTCCGGGACTTT
GGCGTGTCAATGGTGAACATGGGCAGGGTGGGCGTGCTCACCGGCAGCCAGGGGGAGATCCGGAGGACATGCGCCCTTGTCAACTAG

Retrieve as FASTA