Entry information : EcamKat[P]06 (EcC015324.20)
Entry ID 10590
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EcamKat[P]06 (EcC015324.20)
Name (synonym) EcamKat[P]06 (EcC015324.20)
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamKat[P]06
start..stop
S start..stop
EcamKat[P]08 333 1e-114 8..200 1..221
EcamKat[P]08 63 0.00000000001 200..237 369..410
EcamKat[P]04 315 2e-107 8..200 1..222
EgrKat[P]04 313 7e-107 1..200 2..230
EgrKat[P]04 56 0.000000002 179..237 358..420
EguKat[P]04 304 4e-103 1..200 1..229
EguKat[P]04 52 0.00000003 179..236 357..418
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..306 306 N° 2 575..866 292 N° 3 3561..3621 61 N° 4 3710..3760 51
join(1..306,575..866,3561..3621,3710..3760)


exon

Literature and cross-references EcamKat[P]06 (EcC015324.20)
Protein sequence: EcamKat[P]06 (EcC015324.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   234
PWM (Da):   %s   26709.61  
PI (pH):   %s   8.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QTIIYVTGPILLDDYHLVEKLANFDRERIP*SAVHARGACAKGFFEVTHDISHLTRADFLQAPGV*TPVNVRFSILIHERGGPETLRDPRGSHVNFYTRVVRPQSCVQENWRILDFFFHHPESLRLFTFLFDDIGSAQDYMHMQGSGVHTYTLINKARKAHHVKFHRKPTCGxKSLLEEEAIRVGGSNHSHATLDFMISLQTIIEKENNFKQLGERCRSYEWFICR*INALSNPRVT

Retrieve as FASTA  
Remarks Pseudogene from genomic (PS is missing; two ends are missing; stops in frame). Incorrect prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACTATCATCTACGTCACAGGTCCAATTCTTCTTGACGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGAGTGCTGTCCATGCCAGGGGAGCCTGT
GCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCGTGCTGATTTCCTTCAGGCACCAGGAGTTTAAACACCTGTGAATGTCCGTTTCTCCATCCTCATCCACGAAAGG
GGCGGCCCTGAAACCCTGAGGGACCCCCGGGGTTCTCATGTGAACTTCTACACAAGAGTGGTGAGG
GTCGTTTTGGTAGTAGACATGAATGTGCAGTATGGACGGGCACGAGTATGATGC
TCCCTGTGATGAATCCTTTCACAGGTGGCCTAAACTCGACCGATGCATATGGCAGTTCTCTTGTCCACATTGCATACATTTGTTTTGTTGCACTTTGCTATGTGATCTTACCTTTTCTGT
TACTGCAGGGTAACTTCGATCTAGGTAGAACATTTCCATCTCTTATCTGCGATGGGGTGAAATTCCCGGATACGGTTCGTGCACTTAGACCAAACCCCAATCCTGCGTCCAGGAGAACTG
GAGGATCCTTGACTTTTTCTTCCACCATCCTGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATTGGTAGTGCACAAGATTACATGCACATGCAGGGCTCTGGAGTTCACACCTA
CACTTTGATCAACAAGGCCAGAAAAGCGCATCATGTGAAGTTTCACCGGAAACCAACTTGCGGGTCNAAGAGCTTGCTGGAGGAAGAGGCAATTAGAGTCGGGGGATCCAATCACAGCCA
TGCAACTCTGGATTTTATGATTTCAT
TGCTGCTGGAAACTATCCTGAATGNNNNNNNNNNNNNNNNNNNNCCTGCAATGCGATCCTTGACAAAGATTTAACAAGAGACTAGCCTTTAGAG
TTGCTTTCTACTCGCAAAATTCTAATGCCTCAGTTGCATATCCTACTAAATAACAGATTTCAGTTCCATCTGGTCTCGAGAAATAAGTTAAATCTCCATCTCAATGAGCCCTTGACCCTG
TGGATGGGGAGTATCGACTTCCAGATCCACAAGGACCGTCAGCACTCTGATTGTGGTGAATTAGTGATCAATGGTGGTTGTGATGATGCTGGTAAGAAGAAGGCCGGCTCAATGCGCCCG
CCTTGGTCTCCTGGTTTTTCTTACGAATGGTGTTGATATTTTCTAATGTTGCCAGCACTTCTTCCATCGAGGGCCTCGCTTTAGGATCGGCCTCCAGGCATTGGAGGATGAGGTCAGCCG
CCTGAGATGCAGCTATTGGAGGGTATTGACCTTCTAGTCTCGGATCCATTATCGTCCTTAGCTTCCTCTTGTCGTGGAGCAACGGCCCCACCCAATCCACCAGATTCCACTGGCCGTTGG
GGCGAGTACGGTCGATCGCTCGTGAACCCGTCAACATTTCTAGCAGAACCACCCCGAAACCATATACATCACTCTTCATGTACAAATGTCCTGTCAAATTGAGCCTTTATCATTCTGACA
CGCATTTTCTACGATCATATGAAATCTTCGCTAAAGATGAAGAAGCATATGAGAGGGAGATCTCTATGAACAGCGCTGCAGTAAGATCATTTCGCAAAACACGTGCCTAGTAATCACGTC
AATCTTCTAAAGAACGTAGTAGTCACCGACCCAACAGTGCCCACTAAGAAAAAAGATGGGATCTCTGTCTTACCGGTGGCAATGTACTCGGGCGCGGCGTATCCATGTGTTCCGATCACT
TGCGTGGTCACATGAGAGTTCCTGCCTGCCAGTCCCAGCTTTGCTAGCCCGAAATCCGAGCGATTTTGATGAGCAGACACTGCAGTAAATTCATTTCGCAGAACACCTGCCAAGTAATCT
CGTAATCTTCTAAAGAGCGTTGTCGTCACTGATCCAACATTGCCCGCGGAGAAGGAAGATGGGATCTCTGTCTTACTAGTGGCAGAGTACTCGCGAGGGGCATAGCCATCCATCTCGATC
ACTCGCGTGCTCACATAAGAGTCCCCACCCGCTGGCCCCTGTATTGCTAGCCCGAAATCTGAGAGCTTGGCGTTGTAGTCCTAGCGCCACAACGAGAGAAAGAGAACGAAGTTTCTCAAT
TAATCCCCAAGAATGTTAGTTCTACATCCATGTATCATCTAATAATCACAGGCGTAAATCCCATGCACATGGACCGTGTGATCTAAAGGCTCCTCAGCATAAATCTAAAGTATCCGGTGC
ATCAAATGTACGAAGGCGACACCAACCGAAATTGAGATGGTTTAAAGTGAAATTTGAGCTTTGTATAGTTTTACTAGGCGACGTGGGCGACGTTTATACGGTATCCTTAAAAGAAATTCT
TGATAGCTGGAAAAAACAAATGAAAATAATGAAGTAGATAGAAAAATTTACCGCATCCAATAATATATTGGAAGATTTAAAATCCCGGTAGATGACGTTATTCTCGGGTGTATGCAAGAA
TTCAAGCCCGCGGGCAGCTCCGATTGCTACTTTAAGCCTCACGTCCCACGGAAGTGGTTCAGCTTTCCCTGAATTACCATGGGCGTTATTTTATTTTATTTTTACTGTTTGATATCCGAG
TGAAGAAAAAAAAAAAAAAAAGGTAATGCTTAGCGAAAAACAAAAATAGGTAATGCGAATGATCTTACTTCTGAAAAGGTGATTTTCTAAGCTTCCCCTCTTCATGTACTCGTACACAAG
TAGGTAGTGATCGTCTTCCCGGCAATACCCCAATAATTTCACCACATTCGGATGAGAAAGTTTCCCTAAGAACTTGACTTCCGACTGTGGAAGGATAACATAAAATAAACTTTATTGTTA
ACCAATCCACATAAAATTGTGTTGATAGTCAGTTTCGCGATCTTTTGCACAAATCAGGGTGAGTTCAATGTATAATGTGCAGCAATTTGTGGTTTTTTACTATATACGAAAGGCATGTGT
TTACAGCCCAAAATCATAGAGAAAATTCAGGGAAAAGTACAAAAAAAGTCCTAAACCTATTGCATTGGTACCAATTCAGTCTTAAACTTTTCAATTGGACCAATTTAGTCCTAAACCTTT
TAATATTGATACCAATTCAGTTCATCCGGCCAATTTTGGCCAGCCGGTGCTGACATGGATGTCGGCCGGTAGCCGAACGCTGACATGGCAATTTTTATGATTTTTTCGAATTGTTTTATG
ATTTTTTATGATTTTTTATTAATTTGTTTCCTTTTTTCTTTTTTTTTTCCTTTTCTTTTATGCTTTCTTCTTCGTGGTTGCCGGCGAGCCTCCGGTGAGGCTCGCNNNNNNNNNNNNNNN
NNNNNTATGCTGACTGGAAAGCATGAAAAGGTGNGTTTTTAGTTAGGATCNCTTTTACGTAAACAGAGATTGATTGTCTTGAGGTGCTTTCATGGCGATGTCCATGGGATAGACTCAGCT
TGTCCTAGATGAGCAATTGAATTGCAGTGAGTAGTGTGACTGATGTATGTGTTTGGATTTTGTTTACTTTTGTTGCTCCAAACAGACCATCATTGAGAAAGAGAACAACTTCAAGCAGCT
TGGAGAGAGATGCCGATCATA
CAGGTATTCTTCAGTTGCGCATTTCCTGAAAATAGTTTGATGGTCTCGTGTTTCTCAATCGTCTGTCTCTGTTTTCATTTTTCAGGTAAGAGTGGTTCA
TCTGCCGATAGATCAATGCTTTATCTAACCCACGTGTGAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACTATCATCTACGTCACAGGTCCAATTCTTCTTGACGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGAGTGCTGTCCATGCCAGGGGAGCCTGT
GCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCGTGCTGATTTCCTTCAGGCACCAGGAGTTTAAACACCTGTGAATGTCCGTTTCTCCATCCTCATCCACGAAAGG
GGCGGCCCTGAAACCCTGAGGGACCCCCGGGGTTCTCATGTGAACTTCTACACAAGAGTGGTGAGG
CCCCAATCCTGCGTCCAGGAGAACTGGAGGATCCTTGACTTTTTCTTCCACCAT
CCTGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATTGGTAGTGCACAAGATTACATGCACATGCAGGGCTCTGGAGTTCACACCTACACTTTGATCAACAAGGCCAGAAAAGCG
CATCATGTGAAGTTTCACCGGAAACCAACTTGCGGGTCNAAGAGCTTGCTGGAGGAAGAGGCAATTAGAGTCGGGGGATCCAATCACAGCCATGCAACTCTGGATTTTATGATTTCAT
AA
CAGACCATCATTGAGAAAGAGAACAACTTCAAGCAGCTTGGAGAGAGATGCCGATCATA
AGAGTGGTTCATCTGCCGATAGATCAATGCTTTATCTAACCCACGTGTGAC

Retrieve as FASTA