Entry information : EcamKat01 ( EcC020182.10)
Entry ID 10592
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EcamKat01 ( EcC020182.10)
Name (synonym) EcamKat01 ( EcC020182.10)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamKat01
start..stop
S start..stop
EglKat01-1 1006 0 3..504 1..488
EgrKat01-1 1003 0 3..504 5..492
EglKat01-2 994 0 1..504 1..490
EgrKat01-2 988 0 3..504 5..492
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..106 106 N° 2 1110..1387 278 N° 3 3582..4358 777 N° 4 4526..4657 132
N° 5 5160..5227 68 N° 6 5305..5398 94 N° 7 5487..5546 60  
join(1..106,1110..1387,3582..4358,4526..4657,5160..5227,5305..5398,5487..5546)


exon

Literature and cross-references EcamKat01 ( EcC020182.10)
Literature Aekchaweang,K., Apisitwanit,S., Pornbunlualap,S. and Harinasut,P. Submitted (16-JAN-2007) Biochemistry, Kasetsart University, Phaholyothin, Jatujak, Bangkok 10900, Thailand.
mRNA ref. GenBank:   EF221750.2 [Fragment]
Protein sequence: EcamKat01 ( EcC020182.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   504
PWM (Da):   %s   58175.03  
PI (pH):   %s   6.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQPESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFHWKPTCGVKCLLEEEAIRIGGSNHSHATKDLYDSIAAGNYPEWKLYIQVMDPALEDSFDFDPLDMTKIWPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEEELTMSFIHDADSQINYFPSKFDPVRHAERYPIPSQIVTGKRERxIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASRLSARPSM

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 mRNA (EF221750.2). Correct prediction from kazusa. Close to EcS760662.20 which is on a very short contig (Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCAGTATCGCCCGTCCAGCGCTTACGATTCCAGCTTTTGGACAACCAACTACGGTGCTCCCGTCTGGAACAATGACTCATCGCTGACTGTTGGAACTAGAGGTAGTATCGCCATT
ACGGATCTCCAAGTTGTTTTCTTTATCGAAAATAATGATAATTCGATGCTCATCGTGCATGCGTAGATAGTGCTTGCACTCGAACCGGAATATTTTTTTACGTTGCCTTTCTGGTTTGCT
TCATGCGTGTGATTAACACGTGGTTTGTGGTTTTTTATTCTTGATATAATCATTTGAGTACGTTCTTATAAAAAAACGTGCTCGAGGCTCTCGACTGCATCAATGGGTTCTTTTTATTGT
TGTGTTTTGGTGAGTTCGAGGTGTGTACACGCCTTCAACGAATCTGAACTTCTAGGTTATGTAACAATTTAAGGGAAAAAGGCACCAAAAACGCAAAACTATGCTCACTAAGACATATTT
ATTCTAAATTTTCTTGTGACACCAAAAATCCAAAATGTGAACATGTATGACATATTTACTTACGTGGACTATAAAAGCTCTAACTACATGGACTTCAAAAAGCAAATGGAGTCATCTAAC
TTAAGTGAAATTAACTAAAACATCATATGATAGAACTTTGATGGAAATTAAATATATGAGATGTACACAAGTTCGATGTTTTTATGTCAAGAGAAAAAGTTTAGATAAATATATCACAAT
TAATAGAGTTTGAGATTTTTAATATCACAAAAAAAACTCAGGCGTAATATGTCGCAATGGACATAATGTTTTTATCATTTTTTTTTCTCAATATAAAGTATAACTCTACAATTTTTCACT
TTTTGTGTTCTTCAGCAACTTGTGACAGGAAGGAAAAATATCGTAGTTCTCTTTTTTTGATAATCTAGAGGCAAGCACGATTGTGGAAACTCGACCCCTAGGCCTTTTTGGGCCGTGAGG
GGACCCTGACCCACGGCAGAAGAACCTTGTAGTTATATTAGCTGGTCGCAGGAGTATCCTTCTTGGCTCTTCTTGTGCTCTATACGGACATCGTAGTGAAGACACGAAGCTTAACCATCG
TCTAAAAGGAGATTTCTTTCATTGTACAGGTCCGATTCTCCTGGAGGACTACCATCTGATAGAGAAACTTGCCAACTTCGAGAGAGAGAGGATTCCTGAGCGGGTGGTCCATGCACGGGG
AGCCAGCGCGAAAGGGTTCTTCGAGGTCACCCACGACATCTCTCACTTGACCTGTGCTGATTTCCTCCGGGCTCCTGGAGTCCAGACGCCCGTCATCGTCCGTTTCTCCACCGTCATCCA
CGAGCGCGGCAGCCCTGAAACCCTCAGGGACCCTCGTGGTTTTGCAGTGAAGTTCTACACCAGAGAG
GTAACGAGTGATTTTCTTTTTTGAGCAAGGAGAGGTAACGAGTGATCACAAGC
TTTGAATTCTGCAAATTCCATGTTCTTCGATTTTTTTATTGTTATACGTGTATCTGTTTAACTGACTACGCAGGTACTGTGCTTGGCATTTGTGATTGGGGCAGTGTCTTTGGGCGCGTA
TGCTCTGAAGCCTGTGCCGTATAGCCACGTGATGATGGAATTTTTTTTTTTTTTGGTCAGATGATGGAATTTTTTTTGACACTTTGACATGACTAGTTGAAGATGACCTTATCGGAGGGC
TGTAAAACAAAGAGTTTATTTTAAGGAATAATGACGCCTGATATCATAATCTTTATATGTCGCTTACTTTGGGTATTATAAATTTTTCCTGGCCACCTAAATATCATAATTTTTATAAAA
AAATTTCAGTATATTATGACTTTTTTCTGATCACTTAAATGTTATTATTTCTATAAAAAAATGTCAACTATAGTGTCAAAAATTTCAATCAATCACTTAAATGCCAAAATATTTTTAAAA
CATTTACTTAGATATTGAAAATCTAACATGGAATAATGAATGTTTTTAAAAATATAATATCACTTAAGTGATAAAAAAAAAAACAAGTTATAACACTTAATTAAGCCTCATATGTAAATT
ATGGCGTTCAAGTGATAAAAAAATTATGATATTTAAGGGCGTGTTTGGTAACGATTCTGTTCCCGGGAGTAGATTCTGATCAGAACTGATTCTTTTTTATTCTGTTTCCGGGAACTGATT
CTAAGCATTTTAGACCGTTTGATAACTATCCAAAAAATTTTATTCTGGAATAGAATTGCGTTTGATACCGTGTTCATTAATTCTGTTCCAAATCTATTTCTTTTAATTTTTAAATAATTT
TTTTACTTTTTTCCTTTTTTTCTTTTTTTTTTATCTTTTTTCTTTTCTTTTTCTCATCTTCTTCTTCTTCTGGCCGGTCGCCGGACCGGCAACCGGCCAGACGAGGGCCGGCGACCTCAC
CGGAGCGTCGCCGGCCCTCGGCGAGGCCAGTCCTCGTTGGCCGAGCCTTGCCAGCAGTTGGGCGAGGCTCGCCTAGCCCCGCCGGTGGCTAGGCCGGCCTCGTCGGGGTTGGGCAAGGCC
TACCAGGCCACCGGCGGGGCTGGGCGAGCCTCGCCTGGCCACCGGCGGGGCTGGGCGAGCCTCGCCTGGCCACCGGCGGGGCTGGGCGAGCCTCGCCTGGCCACCGGCGGGGCTGGGCGA
GCCTCGCCTGGCCACCGGTGGGGCTAGGTGTCGCGACGCCCAGCCCCTGCCAAGCCTCGCCGGTGGCCAGGCGGGCCTCGCTCGGCCCCAGCGAGGCCTCACCCGGCCTCGCCCAGCCCC
GGCGAGGCCCGCCTCGCCAGATCTGGGGAGGCCGAGCCTCGCCAGTGGCTGGGCTTGCCTCCGGCGAGCTCGCCGAACCTCGCCCTGGTCTGGCAAGCCTCCTGCGAGCTCGCCGGACGG
CGGTGGACGGCAACCGGCGACCGACGGCGGTGGACGGCGGCCGACGGTCGGAGGCGGTGGACGGCAACCGGCGGCCGACGGCGGTGGACGGCGGCGGTGAACGGCGGACAGTGGCGGGCA
GTGGTGGACGACGGTCGCGAGATGGCCGAAGGGAAAAAAAAATTTCTTGATTTTGATTCTCAAATTCGTTCCCGGAACAAGAATCAACTTTTTTTTTTGTTCTTGATTTTATTCCCAATC
TGTTCCCGGAAACAAATTTGTTCCCAAGAACAAAAATTTTACCAAACGCAATTTTAGGCCGAAACTGATTCCGGGAACAAATAATCAGAATTTGGCCTGTTTGGATGGTTACCAAACAAA
GCCTAAGTGAATCTCACACAAAAGTCACGATACTTATAATGCCCTTTTTTTTATTTAAAATAAAAGAGAAAGCTGAACATCAAAAGACAAAAAAAGTTGTCTCTCTTCACACTATTGCAT
TGTCTCGCGTTTCTCTTCTTGATGATTGACTTTATTTCGACACTTCGATGTGACTAGTTGAAGATGAATATTTATCAAAGGGCTGTAATAGAATGGTTCATTTCAAATAAGAGAGAAGTC
AAGACATCAAAACCTAACTAGTATCTCTTCACGTAATTGCGCTGTTTCGCGCTTCACTTCTTTCCTCCTTTCACCGTTCGTTTTTTTTCTTCTGAACGCAGGGAAACTTTGATCTGGTGG
GGATTAATTTCCCAGTCTTCTTCATTCGCGATGCAATGAAATTCCCGGACGCGATCCATGCGTTCAAGCCGAACCCGAAGTCTAACATCCAGGAGATGTGGAGAATCATCGACTTCCTCT
CCCACCAGCCCGAGAGTCTGTCTACGTTCGCATGGTTCTTCGATGATGTCGGCATTCCTCAGGACTACAGGCACATGGAAGGATTCGGCGTGCACGCTTTCACCTTCATCAACAAGGCCG
GAAAGACGAATTACGTGAAATTCCACTGGAAGCCGACTTGTGGTGTGAAGTGCTTGCTGGAGGAGGAGGCGATCCGCATTGGAGGATCGAACCACAGCCACGCGACCAAGGATCTTTACG
ACTCAATCGCTGCTGGCAACTACCCGGAGTGGAAGCTCTACATCCAAGTGATGGATCCTGCTCTTGAAGACAGCTTCGACTTCGATCCGCTGGATATGACAAAGATATGGCCTGAGGACA
TCTTGCCTCTGCAACCAGTAGGCCGCTTGGTGCTGAACCAAAACGTCGATAACTTCTTCGCTGAGAATGAACAGCTTGCGTTTAACCCAGCTTTTGTGGTCCCTGGCATCTATTTCTCCA
ATGATAAGCTTCTCCAAGCTCGGATTTTCGCCTATTCTGATACTCACCGATATCGCCTTGGACCAAACTACCTTCAACTCCCCGTTAATGCTCCCAAGTGCGCTCATCACAACAACCACC
ATGATGGTTTCATGAATTTCATGCACAGGGATGAAGAG
GTAATGATCTTTATTTTTCTGTTTGCTCAATAACGGCACTGAGAATGAACGTGCCTCCAGCATGACCTAATAACATGTTTTT
AGCTGGTTGTACAGAGATCTGAATTGGCTATAGTAGTCTATTGATGCAACGCTCAACTCGACTCAGTTTGTTTTTTGAAAAAAAGGAAGAACTAACGATGTCATTCATCCATGATGCTGA
TTCGCAGATAAATTATTTTCCTTCGAAATTTGATCCCGTTCGCCATGCAGAAAGGTACCCGATACCGTCTCAAATCGTGACTGGAAAGCGAGAAAGG
GTAAGTTTATGGAGTCTATGCAT
TTATAACAAAAAGGACTCTTACAACATGTTCGTGCCTCCAGGATACCAAGTAAAGGAACGGGAATTGTATGCATGGTATTATTAAATCTATTTTGTGTCGATGATTGAGGGGCGGGCTTG
GTAAGGGCTAAAGCAGTTCAGACTCAGCAGAGAATGCCAGAAGAACTAATTACACGCTTGCAATAAAGGCCCGCCCGCGTAACAATGGTTAATCTGTAGCAAGTCGAAAGGCATTGCAGC
AGTGGTGCTTCTGTTTGGACCTTAGATAAAATTGATTTAATTCAATTTCTGGTGTGCCGTTGCGATGGTTATGGTGCTATGATCGTTGGCTTTTACAGACTAAGCTAAGAACTTACAAAT
GAGGAAGGGGATAAGTTAAAACTACAGAAGAGAAGTCGATGTTTTCGTGGCTTGAAAATGTAGCTCTCGGGGTTCACCTTGGATTGGATATCTGTGCTGCTANNNNNNNNNNNNNNNNNN
NNATTATTGAGAAGGAGAACAACTTCAAGCAGGCAGGAGAGAGGTACCGATCCTGGGCGCCGGACAG
GTACCTTTTGACCACTGTCTCCTGAGTCGATGTGCAATTTACTTGGTCACTCA
AATGTCTTTCGACTTTGTCGCCAGGCAAGAGCGTTTCATTAACCGCTGGATCAAGGCATTGTCCGAACCCCGCGTCACCCACGAGCATCGCTCCATCTGGATCTCTTACTGGACTCAGGT
GAGCCATCACTATTCGCCCGGTTTGCTTTCTTTCATGGTACCGAAATTTGTTTATACTGATGGCCCATGACGCATCTTCACCGCAGGCTGACAAATCGATCGGCCAGAAGCTTGCTTCCC
GCCTCAGCGCGCGACCGAGCATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCAGTATCGCCCGTCCAGCGCTTACGATTCCAGCTTTTGGACAACCAACTACGGTGCTCCCGTCTGGAACAATGACTCATCGCTGACTGTTGGAACTAGAGGTCCGATTCTCCTG
GAGGACTACCATCTGATAGAGAAACTTGCCAACTTCGAGAGAGAGAGGATTCCTGAGCGGGTGGTCCATGCACGGGGAGCCAGCGCGAAAGGGTTCTTCGAGGTCACCCACGACATCTCT
CACTTGACCTGTGCTGATTTCCTCCGGGCTCCTGGAGTCCAGACGCCCGTCATCGTCCGTTTCTCCACCGTCATCCACGAGCGCGGCAGCCCTGAAACCCTCAGGGACCCTCGTGGTTTT
GCAGTGAAGTTCTACACCAGAGAG
GGAAACTTTGATCTGGTGGGGATTAATTTCCCAGTCTTCTTCATTCGCGATGCAATGAAATTCCCGGACGCGATCCATGCGTTCAAGCCGAACCCG
AAGTCTAACATCCAGGAGATGTGGAGAATCATCGACTTCCTCTCCCACCAGCCCGAGAGTCTGTCTACGTTCGCATGGTTCTTCGATGATGTCGGCATTCCTCAGGACTACAGGCACATG
GAAGGATTCGGCGTGCACGCTTTCACCTTCATCAACAAGGCCGGAAAGACGAATTACGTGAAATTCCACTGGAAGCCGACTTGTGGTGTGAAGTGCTTGCTGGAGGAGGAGGCGATCCGC
ATTGGAGGATCGAACCACAGCCACGCGACCAAGGATCTTTACGACTCAATCGCTGCTGGCAACTACCCGGAGTGGAAGCTCTACATCCAAGTGATGGATCCTGCTCTTGAAGACAGCTTC
GACTTCGATCCGCTGGATATGACAAAGATATGGCCTGAGGACATCTTGCCTCTGCAACCAGTAGGCCGCTTGGTGCTGAACCAAAACGTCGATAACTTCTTCGCTGAGAATGAACAGCTT
GCGTTTAACCCAGCTTTTGTGGTCCCTGGCATCTATTTCTCCAATGATAAGCTTCTCCAAGCTCGGATTTTCGCCTATTCTGATACTCACCGATATCGCCTTGGACCAAACTACCTTCAA
CTCCCCGTTAATGCTCCCAAGTGCGCTCATCACAACAACCACCATGATGGTTTCATGAATTTCATGCACAGGGATGAAGAG
GAAGAACTAACGATGTCATTCATCCATGATGCTGATTCG
CAGATAAATTATTTTCCTTCGAAATTTGATCCCGTTCGCCATGCAGAAAGGTACCCGATACCGTCTCAAATCGTGACTGGAAAGCGAGAAAGG
NNNATTATTGAGAAGGAGAACAACTTC
AAGCAGGCAGGAGAGAGGTACCGATCCTGGGCGCCGGACAG
GCAAGAGCGTTTCATTAACCGCTGGATCAAGGCATTGTCCGAACCCCGCGTCACCCACGAGCATCGCTCCATCTGGATC
TCTTACTGGACTCAG
GCTGACAAATCGATCGGCCAGAAGCTTGCTTCCCGCCTCAGCGCGCGACCGAGCATGTGA

Retrieve as FASTA