Entry information : EcamKat[P]08 (EcC023042.10)
Entry ID 10593
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-10-30 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamKat[P]08 (EcC023042.10)
Name (synonym) EcamKat[P]08 (EcC023042.10)
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamKat[P]08
start..stop
S start..stop
EgrKat03 697 0 1..433 38..483
GhKat01 683 0 1..435 38..485
NtKat03-1B 683 0 1..426 38..476
VvKat02 680 0 1..433 38..483
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..279 279 N° 2 467..965 499 N° 3 1549..1692 144 N° 4 1716..1814 99
N° 5 2128..2217 90 N° 6 2397..2461 65 N° 7 2546..2681 136  
join(1..279,467..965,1549..1692,1716..1814,2128..2217,2397..2461,2546..2681)


exon

Literature and cross-references EcamKat[P]08 (EcC023042.10)
Protein sequence: EcamKat[P]08 (EcC023042.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   435
PWM (Da):   %s   49792.85  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GPILLDDYHLVEKLANFDRERIP*GVVHARGACAKGFFEVTHDISHLTRADFLQAPGVQTPVTVRFSILIQERGSPETLRDPRGSGVNFYTREGSFDLVGNNFPIFICDGMKFPDMVCALRPNPKSRIQENWRILDFFFHHPESLRLFTFLFDDIGSAQDYRHMQGSGVNTYTLINKARKAHHVKFHWKPTCGxKSLLEAEAIRVGGSNHSHATQDFxDSIAAGNYPEWKLFVQIVSPDHEDNFNFGPIDVAKTWPKDILDNFFAENEQLAFCPSMVVPSIYDSDDKLLQTRIISYSDTRRHHLGPNYPPPPLPFPPNTPKCAHHNNHPEGFTNFMHRDEEINYFPSRYDPVRHAERYPIPPAMLTGKLEKIIEKENNFKQLGERFQSWAPDREWFICR*INALSNP*VTREIRNLWISYWSQVRKPFTSCLVMMGLE

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame; PS is missing; 5' end is missing). Incorrect prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCCAATTCTTCTTGATGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGGGTGTTGTCCATGCCAGGGGAGCCTGTGCAAAGGGATTCTTTGAGGTC
ACTCATGACATTTCTCACCTTACCCGTGCTGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCAAGAAAGGGGCAGCCCTGAAACCCTGAGG
GACCCCCGGGGTTCAGGTGTGAACTTCTACACGAGAGAG
GTGAGGGTCGTTTTGGTAGTAGACATGAATGTGCAGTATGGACGGGCATGAATATGATTCTCCCTGTGACGAATCCTTTCA
CGGGTGGCCTAAACTCGACCGATGCATATGGTAGTTCTCTTTCCACACTGCATACATTTGTTTTGTTGCACTTTGCTATGTGATCTTACCTTTTCTGTTACTGCAGGGTAGCTTTGATCT
GGTAGGAAACAATTTCCCTATCTTCATCTGCGATGGGATGAAATTCCCGGATATGGTTTGTGCACTTAGACCAAACCCCAAATCCCGCATCCAGGAGAACTGGAGGATCCTTGACTTTTT
CTTCCACCATCCCGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATTGGTAGTGCACAAGATTACAGGCACATGCAGGGCTCTGGAGTTAACACCTACACTTTGATCAACAAGGC
CAGAAAAGCGCATCATGTGAAGTTTCACTGGAAACCAACTTGCGGATCNAAGAGCTTGCTGGAGGCAGAGGCAATTAGAGTCGGGGGATCCAATCACAGCCATGCAACTCAGGATTTTGT
NGATTCCATTGCTGCTGGAAACTATCCTGAATGGAAACTTTTCGTTCAGATCGTCAGTCCTGATCATGAAGACAACTTCAACTTTGGCCCAATTGATGTGGCTAAGACCTGGCCCAAGGA
CATAT
TGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAACTTCT
TTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATGGTAGTTCCCAGCATTTACGATTCGGATGATAAGCTGCTCCAAACTCGTATCATCTCATATTCTGATACACGGAGGCACCATC
TTGGACCAAATT
ATCATCAATTCCCAACCACCCCACCCCCCCCCCCCCCCTTCCTTTCCCCCCCAATACTCCTAAATGCGCTCATCACAACAATCACCCTGAAGGTTTCACGAATTTCAT
GCATAGGGATGAAG
AGGTAAGAACCGTCTTTGAATACTTCAGCAGCGATGCTCTGGGCACCATCTCTTGTGGATTTTTTGTTGATGTAACTAGACATCGTGCTTTCCTATAAGCATGTAG
GCGTTGTGATGCAATCTGACATGTCAATTGCGGATCCTAAAGTGGCAGTGCGAATGTCCTCCCTCCTTTTGAGGAAGATTACTTTCTTAATTTTGCAAATGCACTTTGTACCTGAAACAT
ACATACATGTTTACATATGTAGGAAATGCCTGTCTGCTATTATGTAAAATGATTATCTGTTGAGCAAATGCTTAATTTCCCCGTTGCAGATAAACTATTTTCCGTCAAGGTATGATCCTG
TTCGTCATGCAGAGAGATATCCCATTCCACCTGCTATGCTGACTGGAAAGCTTGAAA
AAGGTGTGTTTTTAATTAGGATCTCTTTTACGTAAACAGAGATTGATTGTCTTGAGGTGCTTT
CTTGGCGATATCCATGGGATAGACTCAGCTTGTCCTAGATGATCAATTGAATTGCAGTGAGTAGTGTGACTGATGTATGTGTTTGGATTTTGTTTACTTTTGTTGCTCCAAACAGACCAT
CATTGAGAAAGAAAACAACTTCAAGCAGCTCGGAGAGAGATTCCAATCGTGGGCACCCGAC
AGGTATCTTCAGTTGTTCATTTCCTGAAAATAGTTTGATTGTCTCATGTTTCTCAATCG
TCTGTCTCTGTTTTCATTTTTCAGGTAAGAGTGGTTCATCTGCCGATAGATCAATGCTTTATCTAACCCCTGAGTGACTCGTGAGATCCGCAACCTCTGGATTTCATACTGGTCTCAGGT
GAGAAAGCCATTTACTTCTTGTCTAGTGATGATGGGGTTGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCCAATTCTTCTTGATGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGGGTGTTGTCCATGCCAGGGGAGCCTGTGCAAAGGGATTCTTTGAGGTC
ACTCATGACATTTCTCACCTTACCCGTGCTGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCAAGAAAGGGGCAGCCCTGAAACCCTGAGG
GACCCCCGGGGTTCAGGTGTGAACTTCTACACGAGAGAG
GGTAGCTTTGATCTGGTAGGAAACAATTTCCCTATCTTCATCTGCGATGGGATGAAATTCCCGGATATGGTTTGTGCACTT
AGACCAAACCCCAAATCCCGCATCCAGGAGAACTGGAGGATCCTTGACTTTTTCTTCCACCATCCCGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATTGGTAGTGCACAAGAT
TACAGGCACATGCAGGGCTCTGGAGTTAACACCTACACTTTGATCAACAAGGCCAGAAAAGCGCATCATGTGAAGTTTCACTGGAAACCAACTTGCGGATCNAAGAGCTTGCTGGAGGCA
GAGGCAATTAGAGTCGGGGGATCCAATCACAGCCATGCAACTCAGGATTTTGTNGATTCCATTGCTGCTGGAAACTATCCTGAATGGAAACTTTTCGTTCAGATCGTCAGTCCTGATCAT
GAAGACAACTTCAACTTTGGCCCAATTGATGTGGCTAAGACCTGGCCCAAGGACATAT
NNGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATGGTAGTTCCCAGC
ATTTACGATTCGGATGATAAGCTGCTCCAAACTCGTATCATCTCATATTCTGATACACGGAGGCACCATCTTGGACCAAATT
CCCCCCCCCCCCCCCTTCCTTTCCCCCCCAATACTCCT
AAATGCGCTCATCACAACAATCACCCTGAAGGTTTCACGAATTTCATGCATAGGGATGAAG
AGATAAACTATTTTCCGTCAAGGTATGATCCTGTTCGTCATGCAGAGAGATATCCCATT
CCACCTGCTATGCTGACTGGAAAGCTTGAAA
CCATCATTGAGAAAGAAAACAACTTCAAGCAGCTCGGAGAGAGATTCCAATCGTGGGCACCCGACTAAGAGTGGTTCATCTGCCGATAG
ATCAATGCTTTATCTAACCCCTGAGTGACTCGTGAGATCCGCAACCTCTGGATTTCATACTGGTCTCAGGTGAGAAAGCCATTTACTTCTTGTCTAGTGATGATGGGGTTGG

Retrieve as FASTA