Entry information : EcamGPx06 (EcC043155.30)
Entry ID 10599
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamGPx06 (EcC043155.30)
Name (synonym) EcamGPx06 (EcC043155.30)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx06
start..stop
S start..stop
EgrGPx06 375 2e-134 1..185 1..185
EguGPx06 371 6e-133 1..185 1..185
EglGPx06 275 4e-95 1..185 1..184
EgrGPx07 266 8e-92 1..185 1..179
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..294 294 N° 2 1049..1125 77 N° 3 1334..1395 62 N° 4 1573..1703 131
join(1..294,1049..1125,1334..1395,1573..1703)


exon

Literature and cross-references EcamGPx06 (EcC043155.30)
Protein sequence: EcamGPx06 (EcC043155.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   20357.37  
PI (pH):   %s   9.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCSSTKALLLRCRNLRAPLASSSPSSSALPFPIPFSPSVAEQTLLSPRPISSLPAPGPPIKPPPPFGCRSFVSRDRRSSRAMASQSSKGSIYDFTVKDARGNDVDLGSYKGKVLLIVNVASQCGLTNSNYTELSQVYEKYKNGLEILAFPCNQFGAQEPGTNEQIVEFACTRFKAEYPIFDKVKD

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. 3' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGCTCCTCTACAAAAGCTCTGCTCCTCCGCTGCAGAAATCTCCGCGCCCCTCTCGCCTCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTT
GCTGAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCGCGCCCGGCCCGCCGATCAAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGC
CGTGCCATGGCGAGCCAGTCCTCGAAGGGTTCGATTTACGACTTCACTGTCAAG
GTCGGTTCTCTCTCGAGGTTTCCCTTTTGCAATTTCGCGGGGGAACTGTGAATCGGGAGTCGCCCA
TCGGCAGAAATGTCTACCCATATTATAAAGTTCGCCTTTTTTTTTCAAGTCATTTCTGAGCGAAGATTTTGTTTCTCTTATATCCACAGCGACGCTCCGATTTTGTGTAACTCGGAAAGA
TGACATTTTTATTCAATTGGTGTCGAGACTTTCTTGTAATCTATGTAAAGCTGAGGCCTTTTTCCAAAGCCCCATATCAGAAATGTTAACCTCTATTATAAAGTTCGCCTTTTTTTTTTT
TTTGGGGGGGGGGGGTCATTTCTGAGCGAAGATTTTGTTTTTTTTATATTCACAGCGACGCTTCGATTTTTTTAGCTCAGAAAGATGACATTTTTATGACTTGGTGTTGGGACTTTCTTG
TAATCTATGTAAAGCTGAGGCCTTTTTTTTTTCCAAAGTTCTTTCTGTAGCCTTGTTTTTGGAGGTTTTTGAAAGTTTAGGTGGTAATCTGAAAATGGACCAATCTACAGCACCTTTGAT
GTATAAGCTTCCCTTTTATCTATGTAATTCGCTCAAATATCGGATTTTGTTGATCCAAAATCGAGTTTTGAGTAAGTTGTTGGGGTAAGTTGGTCAGGGAGCGAGATCATGTGTGTCGTG
CCGTGTGCTGAGAGGTTGTGAATCATTTGGGGACCATGATGTTATGCTGTGCTGAGACTTGGAGATTCGGGTTCCTTTTTTTATTCAGGATGCTCGAGGAAATGATGTCGATCTCGGTTC
CTACAAGGGCAAGGTCTTGCTGATTGTCAACGTCGCTTCGCAGTG
GTAATTCTCAGGATTGTGTTTATGCCCCGTTACAGGGAACATCTGGTTGGACTTTAATCTTGGCCGATCTGGTTA
AAAGCAATATCATATTTCATGCCTTTTATCATTTGAAATTCTTTATGCAATTCAGCTTGGGAGTAGCTCAGTGTTTTAGTAATCGGGTTGGTCCACCATGTTCTAATTTTTTTTATCGGT
ATGTTTGTTGCAGTGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAGGTCTCCTATGCCTCCCCTGATCCTGATGTCCCATAGTATCTCGTG
TTTTAGTGGAATCCTGGCCTTAACAGGATAATAAAGATATATCGTATCAGAAAAAGCAGTTGGTTATTGGTATCACTTAGCATATGGAGATTCTAGAAAATTTAAAGAGGATGTCACTCT
GATGTGATGCAGGGTTGGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAGCCGGGGACAAATGAGCAGATCGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCA
TTTTTGATAAGGTAAAAGATATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGCTCCTCTACAAAAGCTCTGCTCCTCCGCTGCAGAAATCTCCGCGCCCCTCTCGCCTCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTT
GCTGAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCGCGCCCGGCCCGCCGATCAAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGC
CGTGCCATGGCGAGCCAGTCCTCGAAGGGTTCGATTTACGACTTCACTGTCAAG
GATGCTCGAGGAAATGATGTCGATCTCGGTTCCTACAAGGGCAAGGTCTTGCTGATTGTCAACGTC
GCTTCGCAGTG
TGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAGGGTTGGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAG
CCGGGGACAAATGAGCAGATCGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAGGTAAAAGATATA

Retrieve as FASTA