Entry information : EcamPrxII03 ( EcC051856.20)
Entry ID 10609
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2012-02-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EcamPrxII03 ( EcC051856.20)
Name (synonym) EcamPrxII03 ( EcC051856.20)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrxII03
start..stop
S start..stop
EguPrxII03 330 2e-118 1..162 1..162
EgrPrxII03 330 2e-118 1..162 1..162
EglPrxII03 330 2e-118 1..162 1..162
CsPrxII02 300 7e-107 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..155 155 N° 2 595..674 80 N° 3 1911..2164 254  
join(1..155,595..674,1911..2164)


exon

Literature and cross-references EcamPrxII03 ( EcC051856.20)
Protein sequence: EcamPrxII03 ( EcC051856.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   17333.06  
PI (pH):   %s   5.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDAIPDGTLAYFDEQDQLQQVSVHSLAAGKKAVLFAVPGAFTPTCSLKHVPGFIENAELLKSKGVDEILCLVNDPFVMKAWAKTYPENKHVKFLADGSAKYTHALGLELDLSEKGLGTRSRRFALLVEDLKVKAANIESGGEFTVSGADEILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCAGCCGGCAAGAAGGCCGTCCTC
TTTGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
GTGAGGGCCGCCGACTGCTTTTTTCTTTCTCGCCGTTCCCTCGTCCTGCGTCGCCGCCGGTTTGCCGTCGCGCGCGGGAGGGAAG
GGAGAGCGGGGGTGAATCGCAGCGCGAGTCGTTCGAAATTCTTTTGCCTAAATCGACGGTTTCATTTCTGTTTTCTAGAATGTTCTGTATTTATTGAGTAGTGTGGAAGTGGTGTTCGAT
GCGATTAGCTTCGTACGGTAGTGGCGAGGCTGTTAGATGCTTGTTTGGACCGAAACGAGTCATGATTCGTGAGCACTTGAATTCGTTTGGAAAATAGTGCATTATGCTGTTGTAATCTCG
TCGGCCTGCTCGATTAAAGATGAGGTTTTTGGAGTGAATAACGCTGGAATTGTAACTAGCGATTGTAGCTTCGATCTTGTGGTATTACCGTTGTTTGTATCGTTCGATTTGCAGTCTGAA
GCACGTGCCGGGCTTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCG
GTATATTCTTCATCTTTTTCCGTCTCTGTGCGATTTCTTTCGTTCT
TTTTTCTTTTTTTTTTTTTTTTGGGTAGAGTTTCTGGGCGATCGTTCCTCTTTCTTTGTCGTCTAATATCGGCGTTTCTTGCTATATCCGCCGATGCTTTGTTTTAAAGGTTACACCTAA
TTGGCTCGGCATGTTTTTGTCCTTAGTGCATCTGCTGGTTAGTGACGAGGTAAAGAAGCTATCTTCAATGAGTCGCCAAATATAATGGTTTCAGCAAGCATCAAGAATCTTAAACTTATA
ATAACGGGGATTGGGGACTGTACTGGTTTTCTGGAGATTACAAGGAAATGCAAAAGGGACTCCAGTTTTGACTTTGAGCAGTTCTTTTGAGGCATTAGTCAGTAGTGGACCATTCCTTGT
AGCATTGCTTTCGTCACCCAATTGCTTGTCCAATTATTAGTTTGGAGTATTCACGAGTTGACTTTGAGCAGTTGTTAGGAGGCATCAGTCAGTAGATAAATATATCACGTGTGATATTTT
TCCGTGTTGCTGCTCTTGAAAATCCATTAAATAGTTACAAACTGTCCTGGATAGCAAAACCCATTTGCCTCCTGGCTTGGTAATGTAGTCGGTGTAAGTCTAATTTCATCTAAAATTGTG
CCTTGTGGTCAAGAGAGATGCACGCTATCTTCAGGATCATCTTGGCCTGGAATCTTCTTGGGAATCTTTAAATAGATGTGATTGGACACTCTCTCTCTCTCTCTGGGTGGACCATGTGGT
TTTACTGTTCACTCAAGCTATTATGCTTATTAACCAAATGCTGGATTGCTAATGACGCAGTGAGTTCAAGATCCTGCTTGGGAAACAACTATAGAAAGCTAGTCCAAAAAGAACTCGGTA
TCTGGGTCCTAGGACACTTGAAAGAGCTTGAATTGAAACTTTGCACTATCATCAGTGAAAATATGGCTTTGCTTAATGCTCTTGTATCTTCGCTTCTCTTGACTTTACTGTTGACCCTGC
ACACTGTACCGAGGATATGTGGATGTGTGAATTCCATATTTGATTCCATAGTTCAGCTCCTAGATGTTGTATGGAGTCTATTAAAGAGTTTGCGCCATCCTTTAGTTAATAAAACGTGCT
AGCTTTAGAACAGATGGCAGTTTGTCTGTCTTAGGTAATTCAGTCCTACCATGTGTTTTTTGTTTTTTTCCACTGAATATCGTGATGCTCATTTTGGTCCTATTTTTCAGTGAATGACCC
ATTTGTGATGAAGGCGTGGGCGAAGACTTACCCCGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCAAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTAAGTGAGAAGGG
GCTTGGTACTCGCTCCAGGAGATTTGCTCTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACTGTCTCCGGCGCTGATGAAATCCTTAAAGCTCT
CTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCAGCCGGCAAGAAGGCCGTCCTC
TTTGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
TCTGAAGCACGTGCCGGGCTTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCGTGAAT
GACCCATTTGTGATGAAGGCGTGGGCGAAGACTTACCCCGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCAAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTAAGTGAG
AAGGGGCTTGGTACTCGCTCCAGGAGATTTGCTCTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACTGTCTCCGGCGCTGATGAAATCCTTAAA
GCTCTCTGA

Retrieve as FASTA