Entry information : OsPrx51 (Os03g55420)
Entry ID 1061
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-12-21 (Christophe Dunand)
Peroxidase information: OsPrx51 (Os03g55420)
Name (synonym) OsPrx51 (Os03g55420)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Endosperm
Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx51
start..stop
S start..stop
BdiPrx01 543 0 1..323 1..324
SbPrx02 528 0 1..323 1..325
SiPrx163 517 0 1..323 1..323
ZmPrx74 512 0 1..323 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31317515..31317724 210 N° 2 31317829..31318029 201 N° 3 31318178..31318343 166 N° 4 31319417..31319814 398
join(31317515..31317724,31317829..31318029,31318178..31318343,31319417..31319814 )


exon

Literature and cross-references OsPrx51 (Os03g55420)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8W5H7
DNA ref. GenBank:   NC_008396.1 (31317515..31319811)
Protein sequence: OsPrx51 (Os03g55420)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   33821.76 (31714.6) Transmb domain:   %s   i7-25o
PI (pH):   %s   4.46 (4.40) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAGIRILVVMLAVAAAGSGVVAQLRRDYYASVCPDVETIVRDAVTKKVQETSVAVGATVRLFFHDCFVEGCDASVIVVSSGNNTAEKDHPNNLSLAGDGFDTVIKARAAVDAVPQCTNQVSCADILVMATRDVIALAGGPSYAVELGRLDGLSSTASSVDGKLPPPSFNLDQLTSLFAANNLSQTDMIALSAAHTVGFAHCGTFASRIQPSAVDPTMDAGYASQLQAACPAGVDPNIALELDPVTPRAFDNQYFVNLQKGMGLFTSDQVLYSDDRSRPTVDAWAANSSDFELAFVAAMTNLGRVGVKTDPSQGNIRRDCAMLI

Retrieve as FASTA  
Remarks chromosome 3. 20 ESTs (mainly callus).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCTGGGATTCGGATTCTGGTGGTGATGTTGGCGGTCGCCGCCGCCGGGAGCGGCGTCGTGGCGCAGCTCAGGCGGGACTACTACGCCAGCGTGTGCCCCGACGTCGAGACCATC
GTGCGCGACGCGGTGACCAAGAAAGTGCAGGAGACGTCCGTCGCCGTCGGCGCCACCGTCCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GTTAGCTAGCTCACACACATCCATCGATAA
TCGATTCCTCCACGGATTTCTCGCTCGAGTCAGGTCAGGAGAATGAAGTGGCCTGGGTGTGAATGTGGGTGCAGGGATGCGACGCGTCGGTGATCGTGGTGTCGTCGGGGAACAACACGG
CGGAGAAGGACCACCCGAACAACCTCTCCCTCGCCGGCGACGGCTTCGACACGGTCATCAAGGCCAGGGCGGCCGTCGACGCCGTGCCGCAGTGCACCAACCAGGTCTCCTGCGCGGACA
TCCTGGTCATGGCCACCCGAGACGTCATTGCGCTG
GTACGTGCACACACACATGACACAAATCCTCGACAAATTAGGCTCCTTTCTTCCGAGATCCATAGAAAAGTTTCCGAGCTTTCGG
AAGATCCCCTGTAAAGTAACACTGAAAAGGCTCTGTTTTCTTTTTTCTTTTTGGATCGTGCAGGCCGGCGGGCCGTCGTACGCCGTGGAGCTCGGGAGGCTGGACGGGCTGAGCTCGACG
GCGAGCAGCGTCGACGGGAAGCTGCCGCCGCCGTCGTTCAACCTGGACCAGCTGACATCGCTGTTCGCCGCGAACAACCTGTCCCAGACCGACATGATCGCTTTATCTG
GTAAGCAACTA
ATCATGCAGTTATTTAACAGTAACCGCTATCCAGAAATAATTTCACTCCACTTTAGCTTCTGTACTAGTGGAATTGTGGAACGCAACTTGTATAGACTAGTTTCTCCATGTGCTTTGTTT
CATTTCATATCTTACAAGTGAAGCAAAGGGGCCCAAATCCAACGCTCAACTGTGCAATTAAAGCCAGAATTTTGAGTGGGCTCAGGAGAATTGTTGGTCAGTACAAAAACGTTTAATCCC
CACAGATTAGAGGAGCAGACAGCATCATCATAGTGAGCGAAAACATTGGGTGAGTGACACTGTAGCTAGCTGATTATTCGGTGATAGTACTTAATAATAGATATAAGAGGAGTCAATGTG
GAGACTGGCTGGAGGACGCCTGGATGCCGTTGCTTGCACGTGAAAAAGAGGTCAGCCTTGTATTATTGTACTAGTGCTATCAGAAACCCTGAAGGCAGGTTGCCGCTGAGGGAACGTCCA
ACTCCTTAATGTCGACCCGTTTATGACTATGGGCCTGCCAAATGAGCTGTCAAAACAGAAGAAAACTAATCCTCTGATATCAGTGCCACGTAGTACTCCTACAAACGGCAGGATAGAAGA
GAAGCAAATTCAGGGTTCTCCTGAAAAACGCATGAACTGTCATGCTGCCAACTAGCCAATCCATTTTACTCAGTTGTTCTAGGTAGGAGTAGTTCATAGCATGAGTGGAAAACGTTTCAG
TTTAGTTCAGTGTTCTGTTCTACTAGTAGCATTGCAATTCTGCAGCTGTTTCCACAGCAGTACTATATCATCCAAAATAGGAATCAACAGGTGTGGGCAGAACTGCATGTGTTTGTCTGT
CACAATGTCCCATTTCTACCTTGGAATGATGGATCATAACTTCACGAGATTCATAACTATGATGACTCTGTGATAAGTTTAACATGTTCAGATAAACTAAAAAAAAGTTAACATGATTTA
TCTGTGCATCTGTAAACTCGTAATTTTGTCCACGCTTTCTGAAGATCTGTGCAGAATTCTGACGGAAACACTAAAAAAAGCTTCGTTTTTTTCTTTTGGCAGCGGCGCACACGGTGGGGT
TCGCGCACTGCGGCACGTTCGCGAGCCGGATCCAGCCGTCGGCGGTGGACCCGACGATGGACGCCGGGTACGCGTCGCAGCTGCAGGCGGCGTGCCCGGCCGGCGTGGACCCGAACATCG
CGCTGGAGCTGGACCCGGTGACGCCGCGCGCCTTCGACAACCAGTACTTCGTCAACCTCCAGAAGGGGATGGGCCTCTTCACCTCCGACCAGGTGCTCTACTCCGACGACCGCTCGCGCC
CCACCGTCGACGCCTGGGCGGCCAACAGCTCCGACTTCGAGCTCGCCTTCGTCGCCGCCATGACCAACCTCGGCCGCGTCGGCGTCAAGACCGACCCGTCGCAGGGCAACATCCGCCGCG
ACTGCGCGATGCTCATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCTGGGATTCGGATTCTGGTGGTGATGTTGGCGGTCGCCGCCGCCGGGAGCGGCGTCGTGGCGCAGCTCAGGCGGGACTACTACGCCAGCGTGTGCCCCGACGTCGAGACCATC
GTGCGCGACGCGGTGACCAAGAAAGTGCAGGAGACGTCCGTCGCCGTCGGCGCCACCGTCCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GGATGCGACGCGTCGGTGATCGTGGTGTCG
TCGGGGAACAACACGGCGGAGAAGGACCACCCGAACAACCTCTCCCTCGCCGGCGACGGCTTCGACACGGTCATCAAGGCCAGGGCGGCCGTCGACGCCGTGCCGCAGTGCACCAACCAG
GTCTCCTGCGCGGACATCCTGGTCATGGCCACCCGAGACGTCATTGCGCTG
GCCGGCGGGCCGTCGTACGCCGTGGAGCTCGGGAGGCTGGACGGGCTGAGCTCGACGGCGAGCAGCGTC
GACGGGAAGCTGCCGCCGCCGTCGTTCAACCTGGACCAGCTGACATCGCTGTTCGCCGCGAACAACCTGTCCCAGACCGACATGATCGCTTTATCTG
CGGCGCACACGGTGGGGTTCGCG
CACTGCGGCACGTTCGCGAGCCGGATCCAGCCGTCGGCGGTGGACCCGACGATGGACGCCGGGTACGCGTCGCAGCTGCAGGCGGCGTGCCCGGCCGGCGTGGACCCGAACATCGCGCTG
GAGCTGGACCCGGTGACGCCGCGCGCCTTCGACAACCAGTACTTCGTCAACCTCCAGAAGGGGATGGGCCTCTTCACCTCCGACCAGGTGCTCTACTCCGACGACCGCTCGCGCCCCACC
GTCGACGCCTGGGCGGCCAACAGCTCCGACTTCGAGCTCGCCTTCGTCGCCGCCATGACCAACCTCGGCCGCGTCGGCGTCAAGACCGACCCGTCGCAGGGCAACATCCGCCGCGACTGC
GCGATGCTCATCTGA

Retrieve as FASTA