Entry information : EcamGPx03 ( EcC063374.10)
Entry ID 10616
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EcamGPx03 ( EcC063374.10)
Name (synonym) EcamGPx03 ( EcC063374.10)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx03
start..stop
S start..stop
EgrGPx03 273 4e-95 1..142 1..142
EguGPx03 233 3e-79 1..142 1..142
EglGPx03 186 4e-61 1..142 1..122
VvGPx01 149 3e-46 1..142 1..141
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..288 288 N° 2 862..938 77 N° 3 1019..1079 61  
join(1..288,862..938,1019..1079)


exon

Literature and cross-references EcamGPx03 ( EcC063374.10)
Protein sequence: EcamGPx03 ( EcC063374.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   142
PWM (Da):   %s   15091.67  
PI (pH):   %s   10.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAPFSAAFSAPSYGFRRAGTNGNFPFPTSLWSPAALRVPSSVRSSLGSCNSAFLVNGLSSSSLPSSSRLSFSSRSSGVYARAATEKTLYDFSVKDIDRNDVSLSKFKGKVLLIVNVASKCGLTTSNYKELSHVYEKYKT

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (3' end is missing due to the ending of contig EcC063374.10. Complete the 3' end with very contig EcS762106.10; Ps is still missing). Close to PS: EcS676708.10 on very short contig (removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCCCCTTTCTCGGCCGCTTTCTCCGCCCCTTCGTACGGCTTCCGTCGAGCCGGAACGAATGGGAACTTCCCCTTTCCGACCTCCCTTTGGTCGCCGGCCGCTCTTCGCGTG
CCGTCATCGGTTCGATCCTCGCTCGGTTCGTGTAATTCGGCTTTTCTCGTTAATGGGTTGTCGTCGTCGTCCCTTCCGAGTTCGTCGCGGCTCAGCTTCAGTTCTCGCTCGTCGGGTGTG
TATGCTAGAGCTGCCACTGAGAAGACCCTCTACGATTTCAGCGTGAAG
GTATCGAATTTCTCTTCTGGGTGTATCTGAAATTGGTATTTGGAGAGATCTTCTTTTTTGGGTCGTCAGGGA
ACTTTGTAATTCACTTAGATACGGTGTTTTTATGTATTTATTTATCTTCGGTAGAATCAAGCAATTCTGATGGCTTGCCCTAGCTACTTTGGAAATTAGAAAAAAATATATATCTTAATT
GTCTCAGCCGCCACACTGTTTTTTGCATCTTCTCTGTTCTATTGTTACTTTTGGATGACGAGGAAGCACATTTTAGCTACTTAACATTGGTGCTTCCAATTTGGACTAAAAGAAATCAAG
CTGGAGTTGAGGTCGCTTATTTGCTCTTTGTTCATGAATTGAACTAATTTGCAAATTCTCCACGGTATGCAAATCCTTAGAATTAAGATTCATGCTGTTGTGGCTAAAAATTCTTCGTTG
TTTTGGCACCTGCTATGTTTCGGTAATTTATGTGGACATTATTATACTATTCATTTTTCGGTTTACATACTGAATTTTGGGTAAAGCTGCTTTATTCATGATAATTGCTAATTGCTGCAC
ACATTTTTCTTCATGGTTCAGGACATTGATAGGAATGATGTTTCATTGAGCAAATTCAAGGGAAAAGTCTTATTAATTGTGAACGTAGCTTCGAAATGGTAATTGCTTTATCTCCTTCAG
TTGTCTGATTTAATTTATCAGATTCACAGTCTCATTGAAGAATTTTCTTGTGATTCAGTGGTTTAACGACATCAAACTACAAGGAGCTCTCGCACGTATATGAGAAGTACAAGACTCAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCCCCTTTCTCGGCCGCTTTCTCCGCCCCTTCGTACGGCTTCCGTCGAGCCGGAACGAATGGGAACTTCCCCTTTCCGACCTCCCTTTGGTCGCCGGCCGCTCTTCGCGTG
CCGTCATCGGTTCGATCCTCGCTCGGTTCGTGTAATTCGGCTTTTCTCGTTAATGGGTTGTCGTCGTCGTCCCTTCCGAGTTCGTCGCGGCTCAGCTTCAGTTCTCGCTCGTCGGGTGTG
TATGCTAGAGCTGCCACTGAGAAGACCCTCTACGATTTCAGCGTGAAG
GACATTGATAGGAATGATGTTTCATTGAGCAAATTCAAGGGAAAAGTCTTATTAATTGTGAACGTAGCTTCG
AAATG
TGGTTTAACGACATCAAACTACAAGGAGCTCTCGCACGTATATGAGAAGTACAAGACTCAA

Retrieve as FASTA