Entry information : OsPrx52 (Os04g01550)
Entry ID 1062
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: OsPrx52 (Os04g01550)
Name (synonym) OsPrx52 (Os04g01550)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx52
start..stop
S start..stop
SiPrx58 397 2e-139 35..331 36..330
SbPrx89 389 7e-137 35..332 10..311
EguPrx48 281 3e-94 36..330 24..318
EglPrx48 280 2e-93 36..330 25..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 367536..367618 83 N° 2 366777..366931 155 N° 3 365952..366710 759  
complement(join(365952..366710,366777..366931,367536..367618))


exon

Literature and cross-references OsPrx52 (Os04g01550)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1P1
DNA ref. GenBank:   NC_008397.1 (367615..365952)
Protein sequence: OsPrx52 (Os04g01550)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332
PWM (Da):   %s   35543.12  
PI (pH):   %s   4.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVGGTADEEANRWMLRRAAMENGEDGGRSPSPEVGYYGATCPDADAIVRQVMERRFYNDNTIAPAIIRMLFHDCFVTLRRFSAHRPHADAPVAGAGGHPQPDLARLEHRQRRQVRPRGRLPGRRLLRRRARPHGAGLLRPPRRHRLRRRARPPRRPPLQLLGGRPPGALLLPRRHAPPLRRQGLHRRRDRPPLRRPHRRRRALLLLPLPPRQAGRRHHGREPPLRHGRRLRPRRPAGGGRLRHDLPRPRHALRRRQRLLRAAHEQQEPPAGGPGGRHARRHGGLRRLLRGQPRRLPAEVLGGDGQARDGRRARGRRRRGQDSLHQVQHX

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 5' and 1). No EST. Incorrect prediction from Phytozome (part of the first intron is missing). Containing IntR (5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGGGCGGCACCGCTGACGAGGAGGCCAACCGTTGGATGCTACGGCGGGCGGCAATGGAGAACGGCGAGGACGGTGGATCTGGCGCTGCCGCCCATCGGGAGGGCCGGATCCAT
CGCCCTTGGGTGCGGCTGCGGCCTCTGCGATAGCATGCGGCGGATCCGACGACGCCGTCCTCGGGTACGTCTGCGAACGGCGGGCGGATCCAGCAGGCAGCAGCTGCTCCTACCCCCAAC
CGTATTGGAAGATTTGATTTTGATCATTTGGGAAAATCTCTTTTGTAGTACTAATGCATATACATGTAATTAATTAAGGGTACGGTGTGGTATGACTTCGAAGCAACCGGCCAATCTCTA
GCTTAACTAGAAGTAGATTAGCATATTACCGATATGATTAGCCGTGCAGCTTGGTAAGTCGTGTTCGTCGTCGTGCAAAAACTGGCACTACAGCTGGATCAAACTGGTACACACGCGTCT
TAACTGAATATCGAATAAAATTAGATCTTATACGAAGATCGAGAGAGTATTAAACTAGCTAGCTATAGCTAAGGTGTCGGCGATGCATGAGATCGATCATGTTGTCTTGTGAGAAGATGC
ATACTAATTAAGCTAGTACTTGACAGCAAGCTAATTAAGCTAGCCATGAGACGCCGCCATGCAGGTGTGCTCCTGATCCTGCAGCTGCAGATCGCCGTCGCCGGAGGTGGGGTACTACGG
CGCGACGTGCCCGGACGCCGACGCCATCGTGCGGCAGGTGATGGAACGCCGCTTCTACAACGACAATACCATCGCCCCCGCCATCATCCGCATGCTCTTCCACGACTGCTTCGTCACCGT
AC
GTACGTGCCATCGATCTGGAGTAGCTAGCTAGGGTTCGTTCATCATATGTTTCATGGCTGCAGGGTTGCGACGCTTCTCTGCTCATCGTCCCCACGCCGACGCGCCCGTCGCCGGAGC
GGGTGGCCATCCCCAACCAGACCTTGCGCGCCTTGAACATCGTCAACGCCGTCAAGTCCGCCCTCGAGGCCGCCTGCCCGGGCGTCGTCTCCTGCGCCGACGCGCTCGCCCTCATGGCGC
GGGACTCCTTCGCCCTCCTCGGCGGCACCGCCTACGACGTCGCGCTCGGCCGCCGCGACGCCCTCCACTCCAACTCCTGGGAGGACGACCTCCCGGCGCCCTTCTCCTCCCTCGACGACA
CGCTCCGCCACTTCGCCGCCAAGGGCTTCACCGCCGACGAGACCGTCCTCCTCTTCGGCGCCCACACCGTCGGCGCCGCGCACTGCTCCTCCTTCCGCTACCGCCTCGCCAGGCCGGACG
ACGGCACCATGGACGAGAGCCTCCGCTGCGACATGGTCGGCGTCTGCGGCCTCGCCGACCAGCCGGCGGCGGCCGACTACGCCATGACCTTCCTCGACCCCGTCACGCCCTTCGCCGTCG
ACAACGCCTACTACGCGCAGCTCATGAGCAACAGGAGCCTCCTGCAGGTGGACCAGGAGGCCGCCACGCACGCCGCCACGGCGGGCTACGTCGCCTACTACGCGGCCAACCCCGACGCCT
TCCTGCAGAGGTTCTCGGAGGTGATGGCCAAGCTCGGGACGGTCGGCGTGCTCGAGGGCGACGCCGGCGAGGTCAGGACAGTCTGCACCAAGTACAACACTAGCTAG

Retrieve as FASTA