Entry information : EcamKat[P]07 (EcS703465.10)
Entry ID 10628
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-03-06 (Qiang Li)
Peroxidase information: EcamKat[P]07 (EcS703465.10)
Name (synonym) EcamKat[P]07 (EcS703465.10)
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamKat[P]07
start..stop
S start..stop
EgrKat[P]07 171 7e-57 1..88 90..177
EglKat[P]07 169 4e-56 1..88 90..177
EgrKat[P]05 172 1e-55 1..88 234..321
EglKat[P]05 172 1e-55 1..88 223..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 70..186 117 N° 2 362..423 62 N° 3 507..591 85  
join(70..186,362..423,507..591)


exon

Literature and cross-references EcamKat[P]07 (EcS703465.10)
Protein sequence: EcamKat[P]07 (EcS703465.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   86
PWM (Da):   %s   10304.18  
PI (pH):   %s   9.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
C*FSLLQINYFPSRYNPVRHAERYPIPTAMLTRKREKGMIEKENNFKQPGERYQSRAPDRQERFIC*WIDALSEPRMTHEIHSIWIS

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (Stops in frame; short PS due to short contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTAATTTTCCCTTTTGCAGATAAACTATTTCCCTTCAAGGTATAATCCCGTTCGTCATGCGGAAAGATATCCCATTCCAACTGCTATGCTGACTAGAAAGCGTGAAAAAGGTATGTTT
TGTAGGATCTCTTTTACTTGGATAGAGATTGATTGTCCTGAGGTGCTTTCATGGTGATATCCATGGGATATAGTCAACTTGTCCTAGATGATCAATTGAATTGCAGCGAGTGGTATGACT
GATGTATGTGTGTTTGGATCTTGTTATCTTTTGTTTCTCCTGGCAGACCAACATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCAATCAAGGGCGCCTGACAGGTATTC
TTCAGTTGTGCATCTCCTGAAAATGGTTTGATTGTCTCATGTTTCTCAATAATCTGTCTCTATCTTTCTTTTCTCAGGCAAGAGCGGTTCATCTGCTGATGGATCGATGCTTTGTCTGAA
CCACGTATGACTCATGAGATCCACAGCATCTGGATTTCATAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTAATTTTCCCTTTTGCAGATAAACTATTTCCCTTCAAGGTATAATCCCGTTCGTCATGCGGAAAGATATCCCATTCCAACTGCTATGCTGACTAGAAAGCGTGAAAAAGGTATGATT
GAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCAATCAAGGGCGCCTGACAG
GCAAGAGCGGTTCATCTGCTGATGGATCGATGCTTTGTCTGAACCACGTATGACTCATGAG
ATCCACAGCATCTGGATTTCATAT

Retrieve as FASTA