Entry information : EcamGPx05 ( EcS722937.10)
Entry ID 10629
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-02-14 (Christophe Dunand)
Peroxidase information: EcamGPx05 ( EcS722937.10)
Name (synonym) EcamGPx05 ( EcS722937.10)
Class Plant glutathione peroxidase     [Orthogroup: Gpx2008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx05
start..stop
S start..stop
EgrGPx05 329 8e-118 1..165 1..165
EguGPx05 326 1e-116 1..165 1..165
EglGPx05 316 6e-113 17..174 1..157
EgrGPx06 289 9e-101 1..165 83..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..48 48 N° 2 663..739 77 N° 3 1027..1088 62 N° 4 1531..1649 119
N° 5 1860..2078 219  
join(1..48,663..739,1027..1088,1531..1649,1860..2078)


exon

Literature and cross-references EcamGPx05 ( EcS722937.10)
Protein sequence: EcamGPx05 ( EcS722937.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   19465.81  
PI (pH):   %s   9.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQSQKASVHDFTVKDARGNDVNLSQYRGKVLLIVNVASQCGLTNSNYTELSKLYEKYRNGLEILAFPCNQFGSQEPGTNEQIQELACTRFKAEYPVFSVDVNGANADPLYKHLKSSKGGFFGDGIKWNFSKFLVDKEGNVVNRYAPTTSPLSFEVKVTERLFRMPYIPNP*

Retrieve as FASTA  
Remarks Partial sequence from genomic last exon is missing). Incorrect prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAATCCCAGAAAGCCTCGGTTCACGACTTCACCGTCAAGGTCTGGGTTTTGGCCGGTTTTCTTAATAACTCGTAAAGGTCTCGCCTTTTCCGTGTTTTTCCCTGTGGATGC
GTGAGAGGGCTTGGGTCGGTTATCTTGATAACTCCTAAATGTCTCGCCTTTTTTGTGTTTTCCCTGTGGATGCGTGAGAGGGGCTTGGGTCGGTTTTCTTAATAACTCGTAAAGGTCTCG
CCTTTTCCGTGTTTTCCCTGCGGATGCGTGAGAGGGCTTGGGCCGGTTTTCTTAATTAACTCGTAAAGGTCTCGCCTTTGTCGTTTTGTGGGATTAGTCGGGCCAAAAGTTCGTGTTCTG
GATTTATAAAGTGAAACGAAAGTAGGAATTTCTGTAGAACTTGTTGACATGATCTTCTGATAAGTACCCTTTTCAAATTTGTATTAGATGTTTGAGGAAGAGAAATAGGTGGGTTTGGCG
AAGTTTTAGTGAAATTGGTCGTGCTCAGTTCGTAGCGCAAACTGCAATAGCTTTTTCGCCTTGAGTCATATTACCGTTGAGTTTGTGTTTGTTAATCAAGTTTGTTCCATGTAACCACAA
ATTGGTCTTTTCGCGATCCTTAATGTGACTTTCTGTTTATTCCATGCTTGCTTTTGTTGTAGGATGCAAGGGGGAATGATGTCAATCTCAGCCAGTACAGGGGGAAAGTCCTGCTGATCG
TCAATGTTGCATCGCAATG
GTAATCGTTTGATTGATGTTCGATATTCCTTTTCGGTCTAAGCTTAATGAGAACATATCTCACCATATTTATGTTCCTGTCCTTGTGGGATAGATTTAGTG
CAAGTGCCAATTTTGTGTTTCTGTTCTTTTATCCCGGGTGCTTCAAAAATCTGTATGGTCATTGTCAACAGATGACAATTGACCAACAAAGTTTCATGAGCAAGCTGTGCCCTTCCAAAT
GATTTCCTTTGATTTGAGATTCTGGTTAAGATTCTTACTGGTGCGCCCCTGCTTGTTGTGATGCAGTGGCTTGACTAACTCAAACTACACAGAGCTGAGTAAGCTTTATGAGAAGTACAG
AAATCAAG
GTATGTTAGTTTTGTTTCTCCCTCTTCGCACAATTTGAATTAGCTCTGATTACTAGACAGTGATGGCTCAGACCAAGCTATTACATTGGTCCCAATGTAGCTGGTATTTTGC
CTGGGAGGAGGACTAATTGCTGCCTTCTTTCCTTATGGTTCCTTCATAGGATGAGTTCATGGATGTAATTTTAGTGAAATTAGGGCTTCTGCAATGAATGAATACACACATTTGGTGTCC
TTTGTTATAAATTGTGAAGCACAGTAGAAGTGGCCCAATGGAGTAAAGGATTCGCAGTCACATGTCAATCTGTTCAACCTTCTGCATCAGACCCAATAATGTCTTACTTTTGTCTAACAA
TTCATTACCCTGGAGTATCAATGGTTTGCACAAATGAAATTTGGGTGGGAAGATGTAAGAAGATGACTCTATTCCCTTACTGCAATGCAGGTCTGGAGATTCTGGCTTTTCCATGCAACC
AATTCGGATCTCAGGAACCAGGGACCAACGAGCAGATCCAAGAACTTGCCTGTACTCGATTTAAGGCTGAATACCCCGTCTTTTCTAAG
GTAAATTTTTTTATTTGTTTTTGTTTTCTTG
GTAGAAGCTTCCGTCAGAATGCTGGATCCAACTCCAACATGGTACGGTAGAACTGCTTACGACTAGGATCTTAATCATACAAATAACTAGATAGACATTGTGGATTTTTAAACCTTCTTC
TCTCTCTCATTACTGGTGAGCAAGATAGTAACAACATTATATGCGTGCACTTGATACAGGTTGATGTGAATGGTGCTAATGCTGATCCATTGTACAAACACCTGAAATCTAGCAAAGGCG
GGTTCTTTGGTGACGGCATCAAGTGGAACTTCTCCAAATTCCTGGTCGACAAAGAGGGGAATGTGGTCAACCGTTACGCTCCAACAACTTCACCCCTAAGTTTTGAGGTAAAAGTAACTG
AGCGCTTGTTTCGCATGCCATATATTCCTAATCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAATCCCAGAAAGCCTCGGTTCACGACTTCACCGTCAAGGATGCAAGGGGGAATGATGTCAATCTCAGCCAGTACAGGGGGAAAGTCCTGCTGATCGTCAATGTTGCATCG
CAATG
TGGCTTGACTAACTCAAACTACACAGAGCTGAGTAAGCTTTATGAGAAGTACAGAAATCAAGGTCTGGAGATTCTGGCTTTTCCATGCAACCAATTCGGATCTCAGGAACCAGGG
ACCAACGAGCAGATCCAAGAACTTGCCTGTACTCGATTTAAGGCTGAATACCCCGTCTTTTCTAAG
GTTGATGTGAATGGTGCTAATGCTGATCCATTGTACAAACACCTGAAATCTAGC
AAAGGCGGGTTCTTTGGTGACGGCATCAAGTGGAACTTCTCCAAATTCCTGGTCGACAAAGAGGGGAATGTGGTCAACCGTTACGCTCCAACAACTTCACCCCTAAGTTTTGAGGTAAAA
GTAACTGAGCGCTTGTTTCGCATGCCATATATTCCTAATCCTTAA

Retrieve as FASTA