Entry information : EcamPrxQ01 ( EcS771313.10)
Entry ID 10633
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EcamPrxQ01 ( EcS771313.10)
Name (synonym) EcamPrxQ01 ( EcS771313.10)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrxQ01
start..stop
S start..stop
EgrPrxQ01 528 0 1..298 1..296
EguPrxQ01 516 0 1..298 1..296
EglPrxQ01 489 2e-177 34..298 5..268
PtPrxQ01 338 1e-118 85..297 1..212
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..100 100 N° 2 274..619 346 N° 3 719..949 231 N° 4 1167..1386 220
join(1..100,274..619,719..949,1167..1386)


exon

Literature and cross-references EcamPrxQ01 ( EcS771313.10)
EST ref. GenBank:   FY806075.1 [5' end]   FY798588.1 [3' end]
Protein sequence: EcamPrxQ01 ( EcS771313.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   298
PWM (Da):   %s   32620.06 Transmb domain:   %s   i58-80o
PI (pH):   %s   10.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLSSDNLAAYWAGQARPTEDLVQSVQFRRSGRRRRRRSATLADPVPSRGAQHSSKRIICLLFSLIFLGPFFFSPSSALVLSSTMATLSLPKHSLRSLLPPQTPRTQSPRTPTFLPKSTQSQFHGLKLSNSSSPSVPSSFSAKSTVFAKVNKGQAPPAFTLKDQDGKTVSLSKFKGKPVVVYFYPADETPGCTKQQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDVGDKVRKDWGVPSDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSA

Retrieve as FASTA  
Remarks Partial sequence from genomic (3 introns) and 4 ESTs. Incorrect prediction from kazusa (5' end is missing due to the ending of contig, complete 3' end with short PS). One intron is missing compared with other Eucalyptus species.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCTCGAGTGATAACTTGGCGGCCTACTGGGCCGGTCAGGCCCGGCCGACCGAGGATCTGGTCCAGTCGGTCCAGTTTCGCCGGTCAGGTCGAAGCCCCGCTCCCTCGAAACGA
AGGCCGGATGGTGTCGTGCCGCGAAGGGCCAGCAATCGTCCACGCCACGAACGACATTGGAAAAGCCAATGAACGACCGCTCCACCTTATCTTTCTTTTCCCCACCACCCGACCAAAAAC
CCGATAACCAAAAAAAAAAAAAAAAAAACAGAGGAAGAAGAAGAAGAAGCGCAACGCTTGCTGATCCGGTCCCAAGCAGAGGCGCACAGCACAGCAGCAAAAGAATAATCTGTTTGCTTT
TTTCTCTTATTTTTCTTGGGCCTTTCTTTTTTTCNCCTTCATCTGCTCTGGTTCTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCGGTCTCTGCTCCCACCTCAGA
CGCCCAGAACCCAATCTCCCCGGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTTCTTCCTTCTCCGCCA
AGAGCACCGTCTTTGCCAA
GGTACATTGTCCCACGTCCAGAGATTTGGAGGCATTTGGAGGGCTAAGCCAAGAGGGTTATTAATGTCTTCCCGTTTCTGTTTGTGGAAACTTCCTGCAGG
TGAACAAAGGCCAAGCCCCGCCAGCCTTCACGCTGAAGGATCAGGACGGCAAGACCGTGAGCCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGC
CAGGATGCACCAAGCAGCAGGCCTGCGCTTTCAGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAGTGGGGACGACTCGTCTTCGCATAA
GGTATTGGACA
AAGTTCACCTGTTTCCTGTAATTGATTATGTGTTTGCATCATTTGAGCTTTTGGAAAATTAATGCTGAAAGCTGTAGGAACAAGTGATAGATTTGTAGGAATGTTTAAGTCTTTCAGGGT
ACATGTTTAATGAAACTGCAATACTCGGATTTTGCACCAAAATGCTAATGTTTCGCTGCTGACAATGAGTTTCATTGTTAACGTCAGGCATTCGCCAAGAAGTATAGACTTCCATTCACA
TTGCTCAGCGATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGGCATTGCCTGGAAGACAGACTTACGTACTCGACAAGAATGGTGTGGTTCAGCTCATT
TACAACAACCAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCTCGAGTGATAACTTGGCGGCCTACTGGGCCGGTCAGGCCCGGCCGACCGAGGATCTGGTCCAGTCGGTCCAGTTTCGCCGGTCAGGTCGAAGAAGAAGAAGAAGAAGCGCA
ACGCTTGCTGATCCGGTCCCAAGCAGAGGCGCACAGCACAGCAGCAAAAGAATAATCTGTTTGCTTTTTTCTCTTATTTTTCTTGGGCCTTTCTTTTTTTCNCCTTCATCTGCTCTGGTT
CTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCGGTCTCTGCTCCCACCTCAGACGCCCAGAACCCAATCTCCCCGGACCCCAACGTTCTTGCCCAAGTCGACGCAG
TCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTTCTTCCTTCTCCGCCAAGAGCACCGTCTTTGCCAA
GGTGAACAAAGGCCAAGCCCCGCCAGCCTTCACG
CTGAAGGATCAGGACGGCAAGACCGTGAGCCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGCCAGGATGCACCAAGCAGCAGGCCTGCGCTTTC
AGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAGTGGGGACGACTCGTCTTCGCATAA
GGCATTCGCCAAGAAGTATAGACTTCCATTCACATTGCTCAGC
GATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGGCATTGCCTGGAAGACAGACTTACGTACTCGACAAGAATGGTGTGGTTCAGCTCATTTACAACAAC
CAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCCTGA

Retrieve as FASTA