Entry information : GluxAPx-CcP02
Entry ID 10643
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxAPx-CcP02
Name GluxAPx-CcP02
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxAPx-CcP02
start..stop
S start..stop
GluxAPx-CcP[P]09 498 2e-176 1..327 133..453
GluxAPx-CcP07 480 1e-169 1..341 131..463
GluxAPx-CcP05 476 8e-169 1..316 60..387
GluxAPx-CcP08 471 6e-166 1..332 133..457
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 374551..374831 281 N° 2 374893..374958 66 N° 3 375074..375251 178 N° 4 375309..375680 372
N° 5 375735..375863 129  
join(374551..374831,374893..374958,375074..375251,375309..375680,375735..375863)


exon

Literature and cross-references GluxAPx-CcP02
DNA ref. JGI genome:   scaffold_46 (374551..375863)
Cluster/Prediction ref. JGI gene:   247481
Protein sequence: GluxAPx-CcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342
PWM (Da):   %s   36438.7  
PI (pH):   %s   4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVAGCGGPFIPFSAGRVDATEAGPPTVPEPQQDLASHTESFHHQGFTPTEMIALIVCGHTLGGVRQVDFPLVVTDSATVLQTFDMTPAFDTAVVPEYLQNTAQNPLVVGPNVTTSLLSPANFNQTCSSLFERMLNTIPSNVNLTNPITEPFNYVVADPQFAYRDGSLSMATALVMNDNPSCTVTLQWTDQQGSFCPPNGCSQQSNGTQNVLFTIIGKMQGVTALRYPFNATINATSSISKFWFEVNENDGSELIVIDNGGAGFVIEQDSVFIDVGRSAIFSVESGGIFDEFVNLVVAVQGDGASTSASVTSFIPTLLNTTNPSFTDPFSTLMMRRLPSD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Check prediction!!!
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTTGCTGGATGCGGAGGCCCCTTCATTCCTTTCAGTGCTGGTCGTGTTGATGCTACAGAGGCCGGACCACCAACTGTCCCAGAGCCACAACAGGATCTTGCTAGCCACACAGAG
TCATTCCATCATCAGGGATTTACCCCCACTGAAATGATAGCTCTCATTGTGTGTGGACATACTCTGGGTGGAGTCAGACAAGTGGACTTTCCTTTGGTTGTTACAGATAGTGCGACAGTT
TTGCAAACTTTTGATATGACACCTGCCTTTGACACCGCCGT
GTAAGTGAAATCTTGGCATATCGATAGTTGTCCACCTGATGAAACTTTGCTTTCTTTGTAGTGTCCCTGAATATCTGCA
AAACACCGCCCAAAATCCGCTTGTTGTAGGCCCGAATGTCACAACCAG
GTCAGGTTTCCATATTTTTTCTAGCAATGGTAATGCCACAATGCAAAGGTATGGCTTGTGCCTCTTCAAGTA
GATTCATCTCCATTAACTGAATTATCTCTTCAATTGGCTCCAGTCTGCTATCTCCGGCCAACTTCAATCAAACATGTTCCAGCCTTTTTGAGCGAATGCTCAACACCATCCCCAGTAATG
TGAATCTTACCAACCCTATCACAGAACCATTCAACTATGTTGTTGCTGACCCTCAGTTTGCCTACCGGGATGGGTCATTGTCCATGGCCACTGCTCTACGC
GTGCGTGTCATCAAGGTTA
TGATCAGTTTGCTCTAAGTTGAGTAACTGTATTGATAGGTTATGAATGACAATCCAAGCTGCACGGTGACTCTGCAGTGGACTGATCAACAGGGATCATTTTGCCCCCCTAATGGTTGCT
CGCAGCAGTCAAACGGTACACAAAATGTATTATTCACCATAATTGGCAAAATGCAAGGCGTTACTGCACTAAGATACCCATTCAATGCAACTATTAATGCGACTTCTTCCATCTCAAAGT
TCTGGTTTGAGGTCAATGAGAATGATGGATCCGAGCTGATTGTTATTGACAATGGAGGCGCTGGATTTGTGATTGAACAAGATTCTGTATTTATTGATGTTGGTCGAAGTGCAATTTTTT
CAGTAGAATCAGGGGGGATATTTGATGAATTTGTGAACCTTGTTGTGGCG
GTATGTGTGCCCTTTTGATATCCTATTTCCCATGAGTGCTTAGAATGCGCATAGGTCCAGGGTGATGGTG
CTTCAACTAGCGCATCAGTAACTTCATTCATTCCCACCCTCTTGAACACTACTAATCCTTCGTTCACAGACCCCTTCTCAACCTTGATGATGCGCAGGCTTCCAAGTGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTTGCTGGATGCGGAGGCCCCTTCATTCCTTTCAGTGCTGGTCGTGTTGATGCTACAGAGGCCGGACCACCAACTGTCCCAGAGCCACAACAGGATCTTGCTAGCCACACAGAG
TCATTCCATCATCAGGGATTTACCCCCACTGAAATGATAGCTCTCATTGTGTGTGGACATACTCTGGGTGGAGTCAGACAAGTGGACTTTCCTTTGGTTGTTACAGATAGTGCGACAGTT
TTGCAAACTTTTGATATGACACCTGCCTTTGACACCGCCGT
TGTCCCTGAATATCTGCAAAACACCGCCCAAAATCCGCTTGTTGTAGGCCCGAATGTCACAACCAGTCTGCTATCTCCG
GCCAACTTCAATCAAACATGTTCCAGCCTTTTTGAGCGAATGCTCAACACCATCCCCAGTAATGTGAATCTTACCAACCCTATCACAGAACCATTCAACTATGTTGTTGCTGACCCTCAG
TTTGCCTACCGGGATGGGTCATTGTCCATGGCCACTGCTCTACGC
GTTATGAATGACAATCCAAGCTGCACGGTGACTCTGCAGTGGACTGATCAACAGGGATCATTTTGCCCCCCTAAT
GGTTGCTCGCAGCAGTCAAACGGTACACAAAATGTATTATTCACCATAATTGGCAAAATGCAAGGCGTTACTGCACTAAGATACCCATTCAATGCAACTATTAATGCGACTTCTTCCATC
TCAAAGTTCTGGTTTGAGGTCAATGAGAATGATGGATCCGAGCTGATTGTTATTGACAATGGAGGCGCTGGATTTGTGATTGAACAAGATTCTGTATTTATTGATGTTGGTCGAAGTGCA
ATTTTTTCAGTAGAATCAGGGGGGATATTTGATGAATTTGTGAACCTTGTTGTGGCG
GTCCAGGGTGATGGTGCTTCAACTAGCGCATCAGTAACTTCATTCATTCCCACCCTCTTGAAC
ACTACTAATCCTTCGTTCACAGACCCCTTCTCAACCTTGATGATGCGCAGGCTTCCAAGTGATTGA

Retrieve as FASTA