Entry information : GluxAPx-CcP04
Entry ID 10646
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxAPx-CcP04
Name GluxAPx-CcP04
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxAPx-CcP04
start..stop
S start..stop
ShirAPx-CcP 425 2e-147 9..354 9..348
HanAPx-CcP04 414 7e-143 27..340 28..338
MvarAPx-CcP03 402 1e-138 4..358 5..352
CgeoAPx-CcP02 401 4e-138 23..346 27..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 550717..550957 241 N° 2 551026..551172 147 N° 3 551234..551427 194 N° 4 551478..551538 61
N° 5 551604..551685 82 N° 6 551744..551781 38 N° 7 551843..551924 82 N° 8 551992..552226 235
join(550717..550957,551026..551172,551234..551427,551478..551538,551604..551685, 551744..551781,551843..551924,551992..552226)


exon

Literature and cross-references GluxAPx-CcP04
DNA ref. JGI genome:   scaffold_4 (550717..552226)
Cluster/Prediction ref. JGI gene:   153711
Protein sequence: GluxAPx-CcP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (337)
PWM (Da):   %s   38532.96 (36304.7) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.32 (4.35) Peptide Signal:   %s   cut: 23 range:23-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTDTAIALVVTLLVTATSSLGAYVWPDHLYDELEHLLVDQEGFNRGAYFRRAITPCTNYVNGDQTLGRMTAAQWLRTAFHDYATANISDGTGGTDASIGWETERPENVGSAFNDSMSFFAPFVNQYVSMADMIALSVVTSVGVCSSPSIHIPFRGGRIDASEGGTFGVPEPETDIGTTLKQFAQTGFNQQDAGLTACGHTLGNVHHGGFPQVVGPEAVTPNNTGGGVHFDSTVDVFDVLVVNEYLEGIGQRGPLVTTDNVTVRSDLRIYASDSNATMRELSTSPDHFISRCVALFSRMLDTVPSTTTLSDVITPLEVKPVNVTLDLVDDEDGVRIIFAGYIRVRCQPSIWPPAVPG

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACTGACACTGCTATTGCTCTGGTCGTAACTCTCCTTGTAACAGCAACTTCCAGCTTAGGTGCATACGTGTGGCCCGACCATCTCTACGACGAGCTAGAGCACCTCCTCGTAGAT
CAGGAAGGGTTCAACCGTGGCGCGTATTTCAGACGCGCCATTACACCATGCACCAATTATGTGAATGGGGATCAGACATTGGGACGGATGACGGCTGCACAATGGTTACGGACGGCTTTT
C
GTGAGCCCCATTCTCTTCCTCCGTGTAGTCAATCGTCCGTTTACTCGGTGGTTATGGTTCGTACACAGATGACTATGCTACAGCCAACATTAGCGACGGCACGGGCGGAACGGATGCTT
CAATTGGCTGGGAAACTGAAAGACCGGAGAATGTGGGATCTGCTTTTAACGATTCAATGAGCTTTTTTGCTCCGTTTGTGAACCAATATGTTTCTA
GTAAGTTCTCTATCATTGCGGTCA
AAATGAATACTCCCTGACAATCCTTTGAATCTTTGAGTGGCTGACATGATCGCCTTGAGTGTCGTCACTTCTGTCGGGGTATGTTCTTCTCCGAGCATACACATACCTTTTCGTGGAGGG
CGCATCGACGCAAGCGAAGGAGGAACTTTTGGCGTTCCGGAACCGGAGACGGATATCGGGACTACTCTGAAGCAGTTTGCGCAAACAGGGTTCAACCAGCAGGATGCTATT
GTATAAATT
TTTGCGCTTGCTTTAGAAATTTGCTAAGATACGTTTTGCAGGGTCTAACGGCGTGCGGCCATACTCTTGGGAACGTGCACCATGGTGGGTTTCCTCAAGTCGGTGAGCATCCGTATTCGC
TGCATACTAAAGTTTTCTCCCTGATTGCAACCTTTTTTTCGGTTCAGTCGGACCAGAAGCTGTAACACCTAACAATACTGGCGGAGGTGTTCATTTCGATTCCACGGTCGATGTTTTCGA
CGTTCTCGT
GTATGTGTCTGTTCTATGCTCGCCCATTATTATTCACGTAGTATTTTCTCCTTCACAGTGTCAATGAATATTTGGAAGGTATTGGACAACGAGGAGGTACAATCCGCAATT
ACTTCGGATGTATAACACTCACTTACGAGCCGTGGCTCTTTTGCAGGTCCCTTGGTGACTACTGACAACGTCACCGTTCGTTCTGACCTTCGCATCTATGCATCGGATAGCAATGCGACT
ATGAGAGA
GTAGGTCAATTATAGACACCCGTGATACCAGACTAATGCATTTGCTTTTACCTCGTTTCCTGAGCAGGTTATCAACTTCACCAGACCACTTTATCTCCAGATGCGTCGCTCT
ATTCTCTCGAATGCTCGACACCGTACCTAGCACGACCACTCTGTCGGACGTCATCACACCGTTAGAGGTCAAACCTGTGAATGTTACTTTGGACCTCGTAGACGATGAAGATGGAGTCCG
AATCATATTTGCTGGTTATATCCGGGTAAGATGCCAGCCCTCTATCTGGCCTCCTGCTGTGCCTGGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACTGACACTGCTATTGCTCTGGTCGTAACTCTCCTTGTAACAGCAACTTCCAGCTTAGGTGCATACGTGTGGCCCGACCATCTCTACGACGAGCTAGAGCACCTCCTCGTAGAT
CAGGAAGGGTTCAACCGTGGCGCGTATTTCAGACGCGCCATTACACCATGCACCAATTATGTGAATGGGGATCAGACATTGGGACGGATGACGGCTGCACAATGGTTACGGACGGCTTTT
C
ATGACTATGCTACAGCCAACATTAGCGACGGCACGGGCGGAACGGATGCTTCAATTGGCTGGGAAACTGAAAGACCGGAGAATGTGGGATCTGCTTTTAACGATTCAATGAGCTTTTTT
GCTCCGTTTGTGAACCAATATGTTTCTA
TGGCTGACATGATCGCCTTGAGTGTCGTCACTTCTGTCGGGGTATGTTCTTCTCCGAGCATACACATACCTTTTCGTGGAGGGCGCATCGAC
GCAAGCGAAGGAGGAACTTTTGGCGTTCCGGAACCGGAGACGGATATCGGGACTACTCTGAAGCAGTTTGCGCAAACAGGGTTCAACCAGCAGGATGCTATT
GGTCTAACGGCGTGCGGC
CATACTCTTGGGAACGTGCACCATGGTGGGTTTCCTCAAGTCG
TCGGACCAGAAGCTGTAACACCTAACAATACTGGCGGAGGTGTTCATTTCGATTCCACGGTCGATGTTTTCGACGTT
CTCGT
TGTCAATGAATATTTGGAAGGTATTGGACAACGAGGAGGTCCCTTGGTGACTACTGACAACGTCACCGTTCGTTCTGACCTTCGCATCTATGCATCGGATAGCAATGCGACTATG
AGAGA
GTTATCAACTTCACCAGACCACTTTATCTCCAGATGCGTCGCTCTATTCTCTCGAATGCTCGACACCGTACCTAGCACGACCACTCTGTCGGACGTCATCACACCGTTAGAGGTC
AAACCTGTGAATGTTACTTTGGACCTCGTAGACGATGAAGATGGAGTCCGAATCATATTTGCTGGTTATATCCGGGTAAGATGCCAGCCCTCTATCTGGCCTCCTGCTGTGCCTGGTTGA

Retrieve as FASTA