Entry information : GluxCcP
Entry ID 10651
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxCcP
Name GluxCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxCcP
start..stop
S start..stop
PgigCcP 496 8e-179 1..265 114..380
MfiaCcP01 490 8e-177 1..265 113..377
LbiCcP01 487 2e-175 1..265 107..371
HsubCcP 480 9e-173 1..265 109..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 693652..693679 28 N° 2 693518..693599 82 N° 3 693182..693452 271 N° 4 693113..693129 17
N° 5 692991..693056 66 N° 6 692858..692935 78 N° 7 692734..692805 72 N° 8 692599..692682 84
N° 9 692450..692549 100  
complement(join(692450..692549,692599..692682,692734..692805,692858..692935,6929 91..693056,693113..693129,693182..693452,693518..693599,693652..693679))


exon

Literature and cross-references GluxCcP
DNA ref. JGI genome:   scaffold_3 (693679..692450)
Cluster/Prediction ref. JGI gene:   35175
Protein sequence: GluxCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265
PWM (Da):   %s   29408.41  
PI (pH):   %s   5.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLDDAGEYDDGSYAPVILRLAWHSSGTYDKDTKTGGSNYATMRFAPESGHGANAGLNVARDLMEKIKQEFPWISYGDLWTLGGVAAVQEMAGPKVPWRPGRIDGVATQATPDGRLPDATQGSDHLRIFGRMGFNDQEIVALSGGHAVGRCHSNRSGFDGPWTFSPTTLTNDFFKLLFDEKWTWKNWNGPKQLEDKSTKSLMMLPTDYVLVQDKSFKKHAKAYAEDNELFFKDFSAAVAKLFELGVPTEQFVTSEPWIMKNADEK

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGATGATGCTGGAGAATACGACGGTAAGCTCGTGGATTTTACGTACCGTTGTTTCTATTCTTATCCTTCTGGTAGACGGTTCCTATGCGCCCGTCATATTGCGCCTTGCATGGCA
CTCTTCGGGTACCTACGATAAGGATACCAAGACCGGTGGAAG
GTACGGCAACTTTCACGTCGAGCAATCAATTCATTCCTTATCATCTATTCATTCTATACTTGTAGCAACTACGCTACG
ATGCGTTTCGCTCCGGAATCCGGACACGGTGCCAACGCTGGTTTGAATGTCGCTCGAGACTTGATGGAAAAGATCAAGCAGGAATTCCCTTGGATCAGTTACGGTGATCTGTGGACCCTA
GGGGGTGTGGCTGCCGTGCAGGAAATGGCTGGTCCCAAGGTCCCGTGGCGCCCAGGACGCATTGACGGCGTTGCGACTCAGGCTACTCCTGACGGACGACTTCCCGATGCCACACAGGGA
TCTGACCATCTTCGAAGG
GTAAGTCTTCTATCAAACTTCGACAGTTTTAGTTTGCTGATCTGCGGAGTAGATCTTTGGTCGTATGGGGTATATTGCGCGTCTTTCATATAAGCATTACCT
TGCTAATGCTTTTTTCCTTCTAGATTCAATGATCAGGAAATTGTTGCTCTATCCGGTGGACATGCTGTTGGTCGCTGCCACAGTAACCGGTAAGAATTTCTTGTGTTCTGAATGGCGATT
ATAGGAGTGCTAATTAGGTTTTAGCTCTGGCTTCGACGGACCCTGGACCTTCTCTCCCACCACTCTGACCAACGACTTTTTCAAACTCTTGTTTGATGAAAAGTATGAAGAGACAATTCA
ATCTCGGTTTACTGATGGACTAATTTTCGTGTAGATGGACCTGGAAGAACTGGAACGGACCCAAGCAGCTTGAGGACAAATCCACAAAATCCTTGATGATGTTGCCGTAAGTCGCTTTTG
GTTGAATGAAGGTAGCTTACAGACGCGTTGTTACCAGTACGGACTACGTTCTTGTTCAGGACAAATCATTCAAAAAGCATGCCAAGGCCTACGCCGAGGACAACGAACTATTCTTCAAAG
A
GTAAGTCGGTGCTATCCTTTGCACAACCTTTGCTTACTGACCTTCACAGTTTCTCTGCTGCCGTTGCCAAGTTATTCGAACTTGGAGTTCCAACTGAGCAATTCGTTACTTCTGAGCCA
TGGATCATGAAGAACGCTGACGAAAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGATGATGCTGGAGAATACGACGACGGTTCCTATGCGCCCGTCATATTGCGCCTTGCATGGCACTCTTCGGGTACCTACGATAAGGATACCAAGACCGGTGGAAGCAACTACGCT
ACGATGCGTTTCGCTCCGGAATCCGGACACGGTGCCAACGCTGGTTTGAATGTCGCTCGAGACTTGATGGAAAAGATCAAGCAGGAATTCCCTTGGATCAGTTACGGTGATCTGTGGACC
CTAGGGGGTGTGGCTGCCGTGCAGGAAATGGCTGGTCCCAAGGTCCCGTGGCGCCCAGGACGCATTGACGGCGTTGCGACTCAGGCTACTCCTGACGGACGACTTCCCGATGCCACACAG
GGATCTGACCATCTTCGAAGG
ATCTTTGGTCGTATGGGATTCAATGATCAGGAAATTGTTGCTCTATCCGGTGGACATGCTGTTGGTCGCTGCCACAGTAACCGCTCTGGCTTCGACGGA
CCCTGGACCTTCTCTCCCACCACTCTGACCAACGACTTTTTCAAACTCTTGTTTGATGAAAA
ATGGACCTGGAAGAACTGGAACGGACCCAAGCAGCTTGAGGACAAATCCACAAAATCC
TTGATGATGTTGCC
TACGGACTACGTTCTTGTTCAGGACAAATCATTCAAAAAGCATGCCAAGGCCTACGCCGAGGACAACGAACTATTCTTCAAAGATTTCTCTGCTGCCGTTGCCAAG
TTATTCGAACTTGGAGTTCCAACTGAGCAATTCGTTACTTCTGAGCCATGGATCATGAAGAACGCTGACGAAAAATAG

Retrieve as FASTA