Entry information : CzmGPx
Entry ID 10655
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: CzmGPx
Name CzmGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Cercospora
Organism Cercospora zeae-maydis    [TaxId: 135779 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CzmGPx
start..stop
S start..stop
MpopGPx01 331 4e-117 28..205 49..228
SpopGPx01 330 2e-116 28..205 59..238
ZcelGPx01 322 1e-113 3..201 4..213
MfiGPx01 312 9e-110 31..208 47..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 501879..502149 271 N° 2 501523..501804 282 N° 3 501391..501464 74  
complement(join(501391..501464,501523..501804,501879..502149))


exon

Literature and cross-references CzmGPx
DNA ref. JGI genome:   scaffold_6 (502149..501391)
Cluster/Prediction ref. JGI gene:   36961 [Incorrect prediction]
Protein sequence: CzmGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   209
PWM (Da):   %s   23001.77  
PI (pH):   %s   9.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPRAATAAISALLSASKPFVLPTTVAFSYRRTTHAAMSSATTFYDFTPKDKKGQDYPLSNLKGKVVLVVNTASKCGFTPQFEGLEKLYKDIKPKHEDFEIIGFPCNQFGGQDPGSNDEIQSFCQLNYGVTFPVLGKTDVNGDKAEPVWEWMKTEKPGIMGLKRVKWNFEKFLIGRDGKVKQRWASTSSPEKIKADIEAALNEKAPAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Incorrect prediction from JGI (5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGCCACGCGCTGCTACTGCTGCAATCTCTGCTCTGCTCTCCGCCTCCAAACCCTTCGTCCTGCCCACCACCGTCGCCTTCTCCTACCGACGCACCACCCACGCCGCCATGTCCTCC
GCCACCACCTTCTACGACTTCACGCCCAAGGACAAGAAGGGCCAGGATTATCCGCTCTCCAACCTCAAGGGCAAGGTCGTCCTGGTCGTCAACACTGCCTCGAAATGCGGCTTCACGCCC
CAGTTTGAGGGCCTGGAGAAGCTGTACAAAG
GTATGACATCGGCCGCGCACACGTGCATCGGAGCCTGCCGCGCGTCTGCATACTGACATGCCCGTGCCCTTCAGACATCAAGCCCAAGC
ACGAAGACTTCGAAATTATCGGCTTCCCATGCAACCAGTTCGGCGGACAGGACCCCGGCAGCAACGATGAGATCCAGAGCTTCTGTCAGCTCAACTACGGCGTCACATTCCCAGTCCTGG
GCAAGACGGACGTGAACGGAGACAAGGCTGAGCCAGTCTGGGAATGGATGAAAACGGAGAAGCCAGGCATCATGGGACTCAAGCGTGTCAAGTGGAACTTTGAGAAGTTCCTCATCGGAA
GAGACGGCAAGGTCAAGCAGCGATGGG
GTATGTGTACAATGACAGTGGGCACAGAGACAAGCCATGCTAACGAGGTCTTCTTCAGCCAGCACAAGCTCTCCGGAAAAGATCAAGGCAGAC
ATCGAAGCTGCACTCAACGAGAAGGCGCCAGCTTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGCCACGCGCTGCTACTGCTGCAATCTCTGCTCTGCTCTCCGCCTCCAAACCCTTCGTCCTGCCCACCACCGTCGCCTTCTCCTACCGACGCACCACCCACGCCGCCATGTCCTCC
GCCACCACCTTCTACGACTTCACGCCCAAGGACAAGAAGGGCCAGGATTATCCGCTCTCCAACCTCAAGGGCAAGGTCGTCCTGGTCGTCAACACTGCCTCGAAATGCGGCTTCACGCCC
CAGTTTGAGGGCCTGGAGAAGCTGTACAAAG
ACATCAAGCCCAAGCACGAAGACTTCGAAATTATCGGCTTCCCATGCAACCAGTTCGGCGGACAGGACCCCGGCAGCAACGATGAGATC
CAGAGCTTCTGTCAGCTCAACTACGGCGTCACATTCCCAGTCCTGGGCAAGACGGACGTGAACGGAGACAAGGCTGAGCCAGTCTGGGAATGGATGAAAACGGAGAAGCCAGGCATCATG
GGACTCAAGCGTGTCAAGTGGAACTTTGAGAAGTTCCTCATCGGAAGAGACGGCAAGGTCAAGCAGCGATGGG
CCAGCACAAGCTCTCCGGAAAAGATCAAGGCAGACATCGAAGCTGCA
CTCAACGAGAAGGCGCCAGCTTCGTAG

Retrieve as FASTA