Entry information : AdelCcP01 (CCP1)
Entry ID 10664
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AdelCcP01 (CCP1)
Name (synonym) AdelCcP01 (CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCcP01
start..stop
S start..stop
SnivCcP01 563 0 5..384 1..366
PoCcP_PC9 548 0 8..385 6..373
SlacCcP01 546 0 5..385 3..372
GtraCcP 540 0 8..385 6..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1376277..1376612 336 N° 2 1376175..1376220 46 N° 3 1376012..1376093 82 N° 4 1375805..1375958 154
N° 5 1375624..1375740 117 N° 6 1375552..1375568 17 N° 7 1375277..1375492 216 N° 8 1375138..1375221 84
N° 9 1374977..1375082 106  
complement(join(1374977..1375082,1375138..1375221,1375277..1375492,1375552..1375 568,1375624..1375740,1375805..1375958,1376012..1376093,1376175..1376220,1376277. .1376612))


exon

Literature and cross-references AdelCcP01 (CCP1)
DNA ref. JGI genome:   scaffold_5 (1376612..1374977)
Cluster/Prediction ref. JGI gene:   111352
Protein sequence: AdelCcP01 (CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   386
PWM (Da):   %s   42153.07  
PI (pH):   %s   9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVLGALRAPARRTGAFAFTALAPTSRPATRSFATTRFLKNAAQPSGSAPKASSNTALYVGLGAFVAGGVGYWFATSDSDAAKSAATAGKSAAQAVKAKTNFVPTKDDYQKVYNKIAETLEVEDYDDGSYGPVYVRLAWHSSGTYDKETNTGGSNYATMRFEPEALHGANAGLDVARGKMEEIKKEFPWISYGDLWTLGGVAAIEAAGPKIPWRPGRIDGFATDATPDGRLPDATQGADHLRHIFYRMGLNDQEIVALAGAHALGRCHPNRSGFDGPWTFSPTTFTNAFYELLFSEKWVWRKWNGPKQLQDKKTQSLMMLPTDYVLITDKSFKQYAKKYAQDEQAFFKDFSAAFAKLMELGVPSQQWATPEPWELKTLDEQKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGTTCTCGGTGCTCTGCGCGCCCCCGCACGCCGCACAGGCGCCTTCGCCTTCACGGCCCTCGCACCGACCTCGCGTCCTGCTACCCGCTCGTTCGCGACCACCCGTTTCCTG
AAGAACGCGGCGCAGCCGTCGGGCTCGGCGCCCAAGGCTTCGTCCAACACCGCCCTTTACGTTGGCCTCGGCGCCTTCGTCGCCGGTGGTGTAGGCTACTGGTTCGCCACCTCCGACTCG
GACGCCGCCAAGAGTGCTGCCACTGCTGGCAAGTCTGCAGCGCAGGCTGTCAAGGCCAAGACCAACTTCGTGCCCACTAAGGACGACTACCAGAAG
GTCTGCCGTACCCCGCGTCTCTCC
TTCTCTCACCTACTGAATGGCTGCGTTCTCAGGTCTACAACAAGATTGCAGAGACTCTGGAGGTCGAGGACTACGATGGTACGCGCAAGCTCGGCCGACGTCGCACCCTGTCAACGCCTT
ACTAACAAACGCCCACCCATTTGCCCTCCAATCGGATAGACGGTTCCTATGGCCCCGTCTACGTCCGTCTGGCATGGCACTCGAGCGGCACATACGATAAGGAAACCAACACCGGCGGCA
G
GTGCGTCGCAGGCTCGGTATTCGGCGCTCGCCCTCGCGCCTAACGTAACACAGCAACTACGCGACGATGCGCTTCGAACCCGAGGCTCTGCACGGCGCCAACGCAGGGCTGGACGTCGC
GCGCGGCAAGATGGAGGAAATCAAGAAGGAATTCCCCTGGATCTCGTACGGCGACCTCTGGACACTCGGCGGTGTTGCGGCTATTCAG
GTTCGCGGAAGACAGCATGCTCCGTCCGTTAT
CGTAAGCCCTTGCTGAGTCTGGCTCTCTGCAGGAGGCAGCGGGTCCCAAGATCCCCTGGCGCCCGGGACGCATTGACGGTTTCGCAACGGACGCTACCCCCGACGGCCGCCTCCCCGACG
CGACGCAGGGCGCTGACCACCTTCGTCAC
GTGCGTATCGCGCACTTCGTTTGTGCGCATCATTCAGTTGCTGATACACTCGCAGATCTTCTATCGCATGGGGTCTGTCACCTTCGCGGCC
GGACCTGCGAAGAGACCGTTACTGACGGTGGCATTTACAGCCTCAACGACCAGGAAATAGTCGCGCTCGCCGGCGCACACGCGCTCGGCCGCTGCCACCCGAACCGCTCCGGCTTCGACG
GCCCCTGGACGTTCTCCCCGACCACTTTCACCAACGCGTTCTACGAGCTGCTCTTCTCGGAGAAGTGGGTCTGGCGCAAGTGGAACGGCCCGAAGCAGCTCCAGGACAAGAAGACGCAGT
CGCTCATGATGCTCCC
GTGCGTGCTTTCGCGAAATTGCGTCTTATGGTGCTTATCAGATGAACCTGTCCAGGACGGACTACGTGCTCATCACTGACAAGTCGTTCAAGCAGTACGCTAAG
AAGTACGCACAGGACGAGCAGGCTTTCTTCAAGGA
GTATGTTGCTCTTCTTTCCCCTCCCAGTTTACCTACTCAACGCAACAAATCGCAGCTTCTCCGCGGCTTTCGCAAAGCTTATGGA
GCTCGGCGTGCCCTCGCAACAGTGGGCCACCCCCGAGCCGTGGGAGCTTAAGACGCTCGACGAGCAGAAGGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGTTCTCGGTGCTCTGCGCGCCCCCGCACGCCGCACAGGCGCCTTCGCCTTCACGGCCCTCGCACCGACCTCGCGTCCTGCTACCCGCTCGTTCGCGACCACCCGTTTCCTG
AAGAACGCGGCGCAGCCGTCGGGCTCGGCGCCCAAGGCTTCGTCCAACACCGCCCTTTACGTTGGCCTCGGCGCCTTCGTCGCCGGTGGTGTAGGCTACTGGTTCGCCACCTCCGACTCG
GACGCCGCCAAGAGTGCTGCCACTGCTGGCAAGTCTGCAGCGCAGGCTGTCAAGGCCAAGACCAACTTCGTGCCCACTAAGGACGACTACCAGAAG
GTCTACAACAAGATTGCAGAGACT
CTGGAGGTCGAGGACTACGATG
ACGGTTCCTATGGCCCCGTCTACGTCCGTCTGGCATGGCACTCGAGCGGCACATACGATAAGGAAACCAACACCGGCGGCAGCAACTACGCGACGATG
CGCTTCGAACCCGAGGCTCTGCACGGCGCCAACGCAGGGCTGGACGTCGCGCGCGGCAAGATGGAGGAAATCAAGAAGGAATTCCCCTGGATCTCGTACGGCGACCTCTGGACACTCGGC
GGTGTTGCGGCTATTCAG
GAGGCAGCGGGTCCCAAGATCCCCTGGCGCCCGGGACGCATTGACGGTTTCGCAACGGACGCTACCCCCGACGGCCGCCTCCCCGACGCGACGCAGGGCGCT
GACCACCTTCGTCAC
ATCTTCTATCGCATGGGCCTCAACGACCAGGAAATAGTCGCGCTCGCCGGCGCACACGCGCTCGGCCGCTGCCACCCGAACCGCTCCGGCTTCGACGGCCCCTGG
ACGTTCTCCCCGACCACTTTCACCAACGCGTTCTACGAGCTGCTCTTCTCGGAGAAGTGGGTCTGGCGCAAGTGGAACGGCCCGAAGCAGCTCCAGGACAAGAAGACGCAGTCGCTCATG
ATGCTCCC
GACGGACTACGTGCTCATCACTGACAAGTCGTTCAAGCAGTACGCTAAGAAGTACGCACAGGACGAGCAGGCTTTCTTCAAGGACTTCTCCGCGGCTTTCGCAAAGCTTATG
GAGCTCGGCGTGCCCTCGCAACAGTGGGCCACCCCCGAGCCGTGGGAGCTTAAGACGCTCGACGAGCAGAAGGCGTAA

Retrieve as FASTA