Entry information : SreGPx (GPX2)
Entry ID 10667
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-05-30 (Nizar Fawal)
Peroxidase information: SreGPx (GPX2)
Name (synonym) SreGPx (GPX2)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Sporisorium
Organism Sporisorium reilianum    [TaxId: 72558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SreGPx
start..stop
S start..stop
UhorGPx01 314 2e-112 1..161 1..161
UmGPx 313 7e-112 1..161 1..161
MresGPx01 227 6e-78 1..159 1..159
MaglGPx01 225 4e-77 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 941758..942009 252 N° 2 942084..942201 118 N° 3 942283..942398 116  
join(941758..942009,942084..942201,942283..942398)


exon

Literature and cross-references SreGPx (GPX2)
Protein ref. UniProtKB:   E6ZXP8
DNA ref. GenBank:   FQ311452.1 (941758..942398)
Protein sequence: SreGPx (GPX2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161
PWM (Da):   %s   17929.04  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSFYELKAKKPSQDEYTFDQLKGKVVLVVNTASKCGYTPQFAELEELNKKYADQGLQILGFPCNQFAGQDPEGDEKIGEFCQRNYGVTFPMMAKSDVNGSNANEVFQFLKKQKAGILGTEMIKWNFTKFLVDKQGNVIERYGSNTKPSAIAPTIEKLLSQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTCCTTCTACGAACTCAAGGCCAAGAAGCCTAGCCAGGACGAATACACGTTCGACCAGCTCAAGGGCAAGGTCGTGCTCGTCGTCAACACCGCCTCCAAGTGCGGTTACACGCCC
CAGTTCGCCGAGCTCGAGGAGCTCAACAAGAAGTACGCCGACCAAGGTCTCCAGATCCTCGGTTTCCCCTGCAACCAGTTTGCTGGCCAGGATCCAGAGGGCGATGAGAAGATCGGCGAG
TTCTGCCAGCGT
GTAAGTGTTTGTTGCTCTCATCCACTCGACTGCGTATTCAGCGCTGACTTTCCGTTCAATCGCTGCTTCCGTAGAACTACGGTGTCACCTTCCCCATGATGGCCAAGT
CCGACGTCAACGGCAGCAACGCCAACGAGGTCTTCCAGTTCCTCAAGAAGCAGAAGGCCGGCATCCTCGGCACCGAGATGATCA
GTATGTTGACCAGCACTTTGCGACACAGCTGACAGG
CGCAAGCTACTGACCACACTGCTCTCCTCATTCAATTGCAAACAGAGTGGAACTTCACCAAGTTCCTCGTCGACAAGCAGGGCAATGTCATCGAGCGATACGGCTCCAACACCAAGCCTT
CCGCCATCGCACCCACCATCGAAAAGCTCCTCTCTCAGTAA

Retrieve as FASTA