Entry information : Sre1CysPrx
Entry ID 10668
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-02 (Christophe Dunand)
Peroxidase information: Sre1CysPrx
Name Sre1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Sporisorium
Organism Sporisorium reilianum    [TaxId: 72558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sre1CysPrx
start..stop
S start..stop
Um1CysPrx 439 7e-160 1..221 1..221
Tcam1CysPrx 318 7e-112 1..201 1..206
Gve1CysPrx 313 3e-110 4..214 1..211
Athi1CysPrx01 313 8e-110 1..213 1..217
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 123407..123462 56 N° 2 123569..124178 610  
join(123407..123462,123569..124178)


exon

Literature and cross-references Sre1CysPrx
Protein ref. UniProtKB:   E6ZWI2
Protein sequence: Sre1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24516.66  
PI (pH):   %s   5.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLRLGSIAPNFTAETTHGVLNFHEYLGDSWGILFSHPDDFTPVCTTELGEVARKEPEFKKRGVKVIGLSANDIASHDAWIKDINEVGKTSVNFPIIGDKDRKVSTEYDMLDALDPTNVDAKGIPFTVRDVFVIDPKKVIRLKISYPASTGRHFDEILRVIDSLQIGDKYRVTTPVNWQKGDKVIVHPSVQGEEAEKLFPGYETVTPYLRFTKDPSATSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 23, 1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGCCTTCGTCTTGGATCCATTGCTCCCAACTTCACCGCCGAGACCACCCAGTACGTACCCGCAACGCACAGCAAACGGCTCCTCCTCCGTTGAAACGGCACTGTATGCTGACCT
CTGCCTTCACTCTGCTCTGCTCTCGATTCTGGACGCTGCCAGCGGTGTGCTCAACTTCCACGAGTACCTCGGCGACTCGTGGGGGATCCTCTTTTCGCACCCGGACGACTTTACGCCCGT
GTGCACCACTGAGCTCGGCGAAGTCGCGCGCAAGGAGCCCGAGTTCAAGAAGCGCGGCGTCAAGGTGATCGGCCTGTCGGCCAACGACATTGCCTCGCACGATGCGTGGATCAAGGACAT
CAACGAGGTCGGCAAGACGTCGGTCAACTTCCCCATCATCGGCGACAAGGACCGCAAGGTGTCGACCGAGTACGACATGCTCGACGCGCTCGACCCCACCAACGTCGACGCCAAGGGCAT
CCCCTTCACCGTGCGCGACGTGTTCGTCATCGACCCCAAGAAGGTGATCCGCCTCAAGATCTCGTACCCCGCCTCGACGGGCCGCCACTTTGACGAGATTCTGCGCGTGATCGACTCGCT
CCAGATCGGCGACAAGTACAGGGTCACCACGCCCGTCAACTGGCAGAAGGGCGACAAGGTCATCGTGCACCCCTCGGTGCAGGGCGAGGAGGCCGAGAAGCTCTTCCCCGGCTACGAGAC
CGTCACGCCCTACCTGCGATTCACCAAGGACCCCTCGGCCACCTCGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGCCTTCGTCTTGGATCCATTGCTCCCAACTTCACCGCCGAGACCACCCACGGTGTGCTCAACTTCCACGAGTACCTCGGCGACTCGTGGGGGATCCTCTTTTCGCACCCGGAC
GACTTTACGCCCGTGTGCACCACTGAGCTCGGCGAAGTCGCGCGCAAGGAGCCCGAGTTCAAGAAGCGCGGCGTCAAGGTGATCGGCCTGTCGGCCAACGACATTGCCTCGCACGATGCG
TGGATCAAGGACATCAACGAGGTCGGCAAGACGTCGGTCAACTTCCCCATCATCGGCGACAAGGACCGCAAGGTGTCGACCGAGTACGACATGCTCGACGCGCTCGACCCCACCAACGTC
GACGCCAAGGGCATCCCCTTCACCGTGCGCGACGTGTTCGTCATCGACCCCAAGAAGGTGATCCGCCTCAAGATCTCGTACCCCGCCTCGACGGGCCGCCACTTTGACGAGATTCTGCGC
GTGATCGACTCGCTCCAGATCGGCGACAAGTACAGGGTCACCACGCCCGTCAACTGGCAGAAGGGCGACAAGGTCATCGTGCACCCCTCGGTGCAGGGCGAGGAGGCCGAGAAGCTCTTC
CCCGGCTACGAGACCGTCACGCCCTACCTGCGATTCACCAAGGACCCCTCGGCCACCTCGGCTTAA

Retrieve as FASTA