Entry information : OsPrx57 (Os04g55740)
Entry ID 1067
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-12-21 (Christophe Dunand)
Peroxidase information: OsPrx57 (Os04g55740)
Name (synonym) OsPrx57 (Os04g55740)
Class Class III peroxidase    [Orthogroup: Prx153]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx57
start..stop
S start..stop
ZmPrx91 547 0 4..319 3..321
SbPrx95 541 0 1..319 1..321
SiPrx55 527 0 22..319 21..320
BdiPrx133 499 2e-180 25..319 28..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33215006..33215218 213 N° 2 33214487..33214678 192 N° 3 33213852..33214406 555  
complement(join(33213852..33214406,33214487..33214678,33215006..33215218))


exon

Literature and cross-references OsPrx57 (Os04g55740)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XMP4
DNA ref. GenBank:   NC_008397.1 (33215218..33213855)
Protein sequence: OsPrx57 (Os04g55740)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   33762.42 (31245.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.44 (4.39) Peptide Signal:   %s   cut: 25 range:25-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYSRQIFVCSAMAALLFSAVVSAQLSTDFYDETCPDALDIIESAVRDAVSKESRMGASLLRLHFHDCFVNGCDGSVLLDDTAAITGEKNAKPNKNSLRGFEVVDDIKSQLEDACEQVVSCADILAVAARDSVVALGGPTWDVELGRRDGTTASLDAANNDLPPPTSDLADLIKSFSDKGLTASDMIALSGAHTIGQARCTNFRGRLYNETNLDATLATSLKPSCPNPTGGDDNTAPLDPATSYVFDNFYYRNLLRNKGLLHSDQQLFSGGSADAQTTAYATDMAGFFDDFRGAMVKMGGIGVVTGSGGQVRVNCRKVN*

Retrieve as FASTA  
Remarks chromosome 4. No ESTs. TC259589
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATTCCAGGCAAATCTTCGTCTGCTCTGCCATGGCTGCGTTGCTCTTCTCTGCTGTTGTTTCGGCGCAGCTCTCCACTGATTTCTACGACGAGACATGCCCCGACGCGCTCGAC
ATCATCGAATCTGCCGTCAGAGACGCCGTTTCCAAGGAGTCTCGCATGGGAGCTTCGCTGCTGCGCCTCCATTTCCACGACTGCTTTGTCAAT
GCAAGTCTCACACAACTCACCCTTTTA
AGTTCAGTTTTCCTTCTCGTTTTCTAGTCCGACCTTTGAAGTAGATGTTTCAATTTCGAAATTCGCTAGTCGCTACAGTTTACTTACTTAGTTACTAGTCGCCAAACATTTTATATTCAG
ATGATTTTTCCCGTGTTCATAAATCATAATAGATATAATTCAGAAGTTCAGAGTGGATGCTGACGGGTCAGTTAAGCAAGTGGTGTGCATGCAGAAAGCGCGCGAAAAGTCTACTTAAAA
GTTAACCTTTTCAAATTCGAAGGACTAACCATTGACCTCAAAAACGGCGCGCGCGTGCAGGGGTGTGACGGGTCAGTGCTGCTCGACGACACGGCGGCCATCACCGGCGAGAAGAACGCG
AAGCCGAACAAGAACTCCCTCCGCGGCTTCGAGGTCGTCGACGACATCAAGTCGCAGCTCGAGGACGCCTGCGAGCAGGTCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGAC
TCCGTCGTCGCC
GTAAGCACCAGACCGGCCGATCACCACTCCGATCCCTGTATTTTTGATGAATTGATCGGGAACGAACGAACTGTGTGCAGCTGGGCGGGCCGACGTGGGACGTCGAGC
TGGGCCGGCGAGACGGGACGACGGCGAGCCTGGACGCGGCGAACAACGACCTCCCGCCGCCGACGTCCGACCTCGCCGACCTGATCAAGTCCTTCTCCGACAAGGGCCTGACGGCGAGCG
ACATGATCGCGCTGTCGGGCGCGCACACCATCGGGCAAGCCAGGTGCACCAACTTTCGCGGCCGCCTCTACAACGAGACCAACCTCGACGCCACCCTCGCCACCTCGCTGAAGCCGAGTT
GCCCCAACCCCACCGGCGGCGACGACAACACGGCGCCGCTCGACCCGGCCACCTCCTACGTGTTCGACAACTTCTACTACAGGAACCTCCTGAGGAACAAGGGCCTTCTGCACTCGGACC
AGCAGCTGTTCAGCGGCGGCTCCGCCGACGCGCAGACCACCGCCTACGCCACCGACATGGCCGGCTTCTTCGACGACTTCCGTGGCGCCATGGTGAAGATGGGCGGCATCGGCGTCGTCA
CCGGCTCCGGTGGCCAGGTCAGGGTTAACTGCAGGAAGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATTCCAGGCAAATCTTCGTCTGCTCTGCCATGGCTGCGTTGCTCTTCTCTGCTGTTGTTTCGGCGCAGCTCTCCACTGATTTCTACGACGAGACATGCCCCGACGCGCTCGAC
ATCATCGAATCTGCCGTCAGAGACGCCGTTTCCAAGGAGTCTCGCATGGGAGCTTCGCTGCTGCGCCTCCATTTCCACGACTGCTTTGTCAAT
GGGTGTGACGGGTCAGTGCTGCTCGAC
GACACGGCGGCCATCACCGGCGAGAAGAACGCGAAGCCGAACAAGAACTCCCTCCGCGGCTTCGAGGTCGTCGACGACATCAAGTCGCAGCTCGAGGACGCCTGCGAGCAGGTCGTCTCC
TGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCC
CTGGGCGGGCCGACGTGGGACGTCGAGCTGGGCCGGCGAGACGGGACGACGGCGAGCCTGGACGCGGCGAACAAC
GACCTCCCGCCGCCGACGTCCGACCTCGCCGACCTGATCAAGTCCTTCTCCGACAAGGGCCTGACGGCGAGCGACATGATCGCGCTGTCGGGCGCGCACACCATCGGGCAAGCCAGGTGC
ACCAACTTTCGCGGCCGCCTCTACAACGAGACCAACCTCGACGCCACCCTCGCCACCTCGCTGAAGCCGAGTTGCCCCAACCCCACCGGCGGCGACGACAACACGGCGCCGCTCGACCCG
GCCACCTCCTACGTGTTCGACAACTTCTACTACAGGAACCTCCTGAGGAACAAGGGCCTTCTGCACTCGGACCAGCAGCTGTTCAGCGGCGGCTCCGCCGACGCGCAGACCACCGCCTAC
GCCACCGACATGGCCGGCTTCTTCGACGACTTCCGTGGCGCCATGGTGAAGATGGGCGGCATCGGCGTCGTCACCGGCTCCGGTGGCCAGGTCAGGGTTAACTGCAGGAAGGTCAATTAA

Retrieve as FASTA