Entry information : SrePrxV
Entry ID 10671
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-02 (Christophe Dunand)
Peroxidase information: SrePrxV
Name SrePrxV
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Sporisorium
Organism Sporisorium reilianum    [TaxId: 72558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SrePrxV
start..stop
S start..stop
UmPrxV 314 6e-112 3..173 2..172
SjapPrxV01 157 4e-50 19..173 5..155
TmelPrxV02 152 4e-48 44..173 29..156
SlutPrxV01 145 6e-45 28..170 36..175
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43779..43951 173 N° 2 43341..43689 349  
complement(join(43341..43689,43779..43951))


exon

Literature and cross-references SrePrxV
Protein ref. UniProtKB:   E7A231
DNA ref. GenBank:   FQ311473.1 (43951..43341)
Protein sequence: SrePrxV
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   18216.38  
PI (pH):   %s   5.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSFTDKIKATIKGDVKEGAKLEAGIKLKESNPEQADVSLDNLTGKSVIVGVPGAFTPPCSSQVPGYIEHAAEFESKGVKDIYIVAVNDQFTVQAWKGKLGGDKAPNVHFLADDTGAFTKALGQDFDATGLLGNHRSKRYAFVVEGGVVRKAFVEDNAPDVTVTSAENVLKAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCGTTCACCGACAAGATCAAGGCCACCATCAAGGGCGACGTCAAGGAAGGCGCCAAGCTCGAGGCGGGCATCAAGCTCAAAGAGTCGAACCCCGAGCAGGCCGATGTGTCGCTC
GACAACCTGACGGGCAAGTCGGTCATCGTAGGTGTGCCCGGTGCCTTTACTCC
GTAAGTTGCTCGCCATCGTCACTTTCCACCGCCTTCGCTTGACTGACACTGTTCTACTCTATACTTT
GCCCTCTCCTTGCTGTCCGCAGCCCCTGCTCGTCGCAAGTACCCGGCTACATCGAGCACGCAGCCGAGTTCGAGTCCAAGGGCGTCAAGGACATCTACATTGTCGCCGTCAACGACCAGT
TCACCGTCCAGGCGTGGAAGGGGAAGCTCGGCGGCGACAAGGCGCCCAACGTCCACTTCCTCGCCGACGACACGGGTGCGTTCACCAAGGCGCTCGGCCAGGACTTTGACGCCACGGGTC
TGCTCGGCAACCACCGCTCCAAGCGCTATGCGTTTGTGGTCGAGGGCGGCGTGGTGCGCAAGGCGTTTGTCGAGGACAATGCTCCCGACGTGACTGTTACGTCGGCTGAGAATGTTCTCA
AGGCTATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCGTTCACCGACAAGATCAAGGCCACCATCAAGGGCGACGTCAAGGAAGGCGCCAAGCTCGAGGCGGGCATCAAGCTCAAAGAGTCGAACCCCGAGCAGGCCGATGTGTCGCTC
GACAACCTGACGGGCAAGTCGGTCATCGTAGGTGTGCCCGGTGCCTTTACTCC
CCCCTGCTCGTCGCAAGTACCCGGCTACATCGAGCACGCAGCCGAGTTCGAGTCCAAGGGCGTCAAG
GACATCTACATTGTCGCCGTCAACGACCAGTTCACCGTCCAGGCGTGGAAGGGGAAGCTCGGCGGCGACAAGGCGCCCAACGTCCACTTCCTCGCCGACGACACGGGTGCGTTCACCAAG
GCGCTCGGCCAGGACTTTGACGCCACGGGTCTGCTCGGCAACCACCGCTCCAAGCGCTATGCGTTTGTGGTCGAGGGCGGCGTGGTGCGCAAGGCGTTTGTCGAGGACAATGCTCCCGAC
GTGACTGTTACGTCGGCTGAGAATGTTCTCAAGGCTATCTGA

Retrieve as FASTA