Entry information : BbotCcP
Entry ID 10674
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: BbotCcP
Name BbotCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Botryobasidiaceae Botryobasidium
Organism Botryobasidium botryosum    [TaxId: 264124 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BbotCcP
start..stop
S start..stop
SnivCcP01 525 0 2..371 1..365
AdelCcP01 525 0 1..373 4..385
SlacCcP01 516 0 2..373 3..372
PoCcP_PC9 516 0 1..373 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 814535..814880 346 N° 2 814395..814476 82 N° 3 814312..814325 14 N° 4 813989..814245 257
N° 5 813895..813911 17 N° 6 813761..813826 66 N° 7 813629..813706 78 N° 8 813486..813557 72
N° 9 813338..813421 84 N° 10 813170..813272 103  
complement(join(813170..813272,813338..813421,813486..813557,813629..813706,8137 61..813826,813895..813911,813989..814245,814312..814325,814395..814476,814535..8 14880))


exon

Literature and cross-references BbotCcP
DNA ref. JGI genome:   scaffold_1 (814880..813170)
Cluster/Prediction ref. JGI gene:   61138
Protein sequence: BbotCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   40989.52  
PI (pH):   %s   6.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLATLRVSSRRVATRSLHTSPVAPRAAFRKFSTIPPPPPKASSNTAIYIGLGLAAVGGAGYFFLNSGTDASREAGTAIKSAGQSIKAATPFVPSKEDYQKVYNRVAEILDADDYDDGSYGPLLVRLAWHCSGTYDKDSNTGGSNNAMRFAPESLHAANNGLVLARGIMETLHDEFPWISYGDLWTLAGVAAIQEMAGPKIPWRPGRIDGLEKNATPDGRLPDATQGQDHLRIFYRMGFDDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTTVTNAFYTLLLNEKWTWRKWSGPKQYEDKGSKSLMMLPSDMALVQDKKFAVWVKKYAADEELWFKDFSSAFARLLELGVPTSQFITAEPWEMKTIDEQS

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGCTACACTCCGTGTTTCTTCTCGTCGCGTCGCGACTCGTTCTCTTCACACCTCGCCTGTCGCGCCTCGCGCGGCCTTCCGCAAATTTTCTACTATCCCGCCGCCACCGCCCAAG
GCTTCCAGCAACACAGCCATTTACATAGGTCTCGGTCTCGCCGCTGTCGGTGGTGCAGGATACTTTTTCTTGAACTCTGGCACTGATGCCAGCAGGGAGGCGGGGACTGCCATCAAGTCT
GCGGGGCAGTCGATTAAGGCAGCGACGCCCTTCGTTCCTAGCAAGGAGGACTACCAGAAGGTCTATAATAGAGTTGCTGAGATTCTGGATGCCGATGATTATGACG
GCGAGCTCGTCCTT
ATTTAGCTGTCGTTGATCACTTTTTGCTTATTCCTCGAACGTAGATGGTAGCTACGGACCCCTCCTCGTTCGTCTCGCTTGGCACTGCAGCGGTACCTATGATAAGGATAGCAACACTGG
TGGCAG
GTACGCGTTATACAACCTGTCTTCCTATCAAAAATGGCACTTATTTATTCGTTCGCTTTGCCTGAACAGCAACAACGCGACTAGTAAGTCCCCGACTTTCTTTGCGCATCCACA
ATGACGACGTCTCACATTTTCCTGTCCACTACTAGTGCGTTTCGCTCCCGAGTCTCTGCATGCCGCTAACAATGGCCTCGTCCTTGCTCGTGGAATAATGGAAACGCTCCACGATGAGTT
CCCTTGGATCTCCTACGGAGACCTGTGGACTCTTGCCGGTGTCGCTGCCATTCAGGAAATGGCTGGTCCCAAGATCCCATGGAGGCCCGGAAGGATCGATGGACTTGAGAAAAATGCCAC
CCCTGACGGTAGGCTGCCAGATGCTACACAGGGGCAGGACCACTTGCGCGCT
GTGGGTTGCTTGCACTACGTCGCTTCAACGGCCTCTTCACTACTAATCATTATACCCGTTTGGTTTGA
TTTTACCAGATCTTCTACCGCATGGGGTATGCTTATTTCCCATACCGGCATTGCTTACTTTGCTGAGAGAGTGTGCTGTATATGACCGCTATAGCTTCGATGACCAAGAGATCGTTGCCC
TCGCCGGTGCGCATGCCCTTGGTCGCTGCCATACCGATCG
GTGTGTTCATTCTGTGTCGTTGATGATCAAAAATACTAAACGGGTCTTTCATAGTTCCGGCTTCGATGGCCCCTGGACCT
TCTCGCCTACCACCGTGACGAATGCCTTCTACACCCTTTTGCTTAACGAAAA
GTACAAGTTTCCTTAAAATATATATACAGGTTCGCAGCTGAACCTGACTCTTTGCCGCTCAATCACAT
CAGGTGGACATGGCGCAAGTGGTCTGGCCCTAAGCAATACGAAGACAAGGGCAGCAAGTCTTTGATGATGCTTCCGTGAGTCACTCAGCGTACTGAAGTAATTCAATCAAGTCCTGACAG
TATGACTTGCCTTGCGTAGCTCCGACATGGCTCTCGTCCAGGATAAGAAATTTGCGGTTTGGGTGAAGAAGTATGCTGCAGATGAGGAATTGTGGTTCAAAGAGTACGTGCCTTGGACCC
ACATCCACCCTATCCCATAGCTCAACTTTCTTACCTACGATCGTGTAGCTTCTCCTCTGCCTTTGCTCGTCTGCTGGAGCTTGGTGTCCCCACCTCCCAGTTCATCACCGCCGAGCCTTG
GGAGATGAAGACCATCGACGAGCAGTCTTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGCTACACTCCGTGTTTCTTCTCGTCGCGTCGCGACTCGTTCTCTTCACACCTCGCCTGTCGCGCCTCGCGCGGCCTTCCGCAAATTTTCTACTATCCCGCCGCCACCGCCCAAG
GCTTCCAGCAACACAGCCATTTACATAGGTCTCGGTCTCGCCGCTGTCGGTGGTGCAGGATACTTTTTCTTGAACTCTGGCACTGATGCCAGCAGGGAGGCGGGGACTGCCATCAAGTCT
GCGGGGCAGTCGATTAAGGCAGCGACGCCCTTCGTTCCTAGCAAGGAGGACTACCAGAAGGTCTATAATAGAGTTGCTGAGATTCTGGATGCCGATGATTATGACG
ATGGTAGCTACGGA
CCCCTCCTCGTTCGTCTCGCTTGGCACTGCAGCGGTACCTATGATAAGGATAGCAACACTGGTGGCAG
CAACAACGCGACTATGCGTTTCGCTCCCGAGTCTCTGCATGCCGCTAACAAT
GGCCTCGTCCTTGCTCGTGGAATAATGGAAACGCTCCACGATGAGTTCCCTTGGATCTCCTACGGAGACCTGTGGACTCTTGCCGGTGTCGCTGCCATTCAGGAAATGGCTGGTCCCAAG
ATCCCATGGAGGCCCGGAAGGATCGATGGACTTGAGAAAAATGCCACCCCTGACGGTAGGCTGCCAGATGCTACACAGGGGCAGGACCACTTGCGCGCT
ATCTTCTACCGCATGGGCTTC
GATGACCAAGAGATCGTTGCCCTCGCCGGTGCGCATGCCCTTGGTCGCTGCCATACCGATCG
TTCCGGCTTCGATGGCCCCTGGACCTTCTCGCCTACCACCGTGACGAATGCCTTCTAC
ACCCTTTTGCTTAACGAAAA
GTGGACATGGCGCAAGTGGTCTGGCCCTAAGCAATACGAAGACAAGGGCAGCAAGTCTTTGATGATGCTTCCCTCCGACATGGCTCTCGTCCAGGATAAG
AAATTTGCGGTTTGGGTGAAGAAGTATGCTGCAGATGAGGAATTGTGGTTCAAAGA
CTTCTCCTCTGCCTTTGCTCGTCTGCTGGAGCTTGGTGTCCCCACCTCCCAGTTCATCACCGCC
GAGCCTTGGGAGATGAAGACCATCGACGAGCAGTCTTCT

Retrieve as FASTA